"GRB2" Related Products

Expand
Expand
Expand

Recombinant Human GRB2 protein, T7/His-tagged

Cat.No.: GRB2-127H
Product Overview: Recombinant human GRB2 cDNA (2 – 217 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGSEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFI PKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVV KFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGAC HGQTGMFPRNYVTPVNRNV
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro protein mediated Wnt / b-catenin pathway regulation study in tumor cell transformation or ES cell differentiation with this protein as either coating matrix protein or soluble factor.2. May be used for GRB2 protein-protein interaction assay.3. Enzymatic substrate for various proteases.4. As antigen for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: GRB2 growth factor receptor-bound protein 2 [ Homo sapiens ]
Official Symbol: GRB2
Synonyms: GRB2; growth factor receptor-bound protein 2; NCKAP2; HT027; protein Ash; SH2/SH3 adapter GRB2; abundant SRC homology; growth factor receptor-bound protein 3; epidermal growth factor receptor-binding protein GRB2; ASH; Grb3-3; MST084; MSTP084; EGFRBP-GRB2;
Gene ID: 2885
mRNA Refseq: NM_002086
Protein Refseq: NP_002077
MIM: 108355
UniProt ID: P62993
Chromosome Location: 17q24-q25
Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Antigen Activates B Cell Receptor Leading to Generation of Second Messengers, organism-specific biosystem; Axon guidance, organism-specific biosystem;
Function: SH3/SH2 adaptor activity; ephrin receptor binding; epidermal growth factor receptor binding; insulin receptor substrate binding; neurotrophin TRKA receptor binding; phosphoprotein binding; phosphotyrosine binding; protein binding; protein domain specific

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.