Recombinant Human GRB2 protein, T7/His-tagged
| Cat.No. : | GRB2-127H |
| Product Overview : | Recombinant human GRB2 cDNA (2 – 217 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 2-217 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGSEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFI PKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVV KFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGAC HGQTGMFPRNYVTPVNRNV |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro protein mediated Wnt / b-catenin pathway regulation study in tumor cell transformation or ES cell differentiation with this protein as either coating matrix protein or soluble factor.2. May be used for GRB2 protein-protein interaction assay.3. Enzymatic substrate for various proteases.4. As antigen for specific antibody production. |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | GRB2 growth factor receptor-bound protein 2 [ Homo sapiens ] |
| Official Symbol | GRB2 |
| Synonyms | GRB2; growth factor receptor-bound protein 2; NCKAP2; HT027; protein Ash; SH2/SH3 adapter GRB2; abundant SRC homology; growth factor receptor-bound protein 3; epidermal growth factor receptor-binding protein GRB2; ASH; Grb3-3; MST084; MSTP084; EGFRBP-GRB2; |
| Gene ID | 2885 |
| mRNA Refseq | NM_002086 |
| Protein Refseq | NP_002077 |
| MIM | 108355 |
| UniProt ID | P62993 |
| Chromosome Location | 17q24-q25 |
| Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Antigen Activates B Cell Receptor Leading to Generation of Second Messengers, organism-specific biosystem; Axon guidance, organism-specific biosystem; |
| Function | SH3/SH2 adaptor activity; ephrin receptor binding; epidermal growth factor receptor binding; insulin receptor substrate binding; neurotrophin TRKA receptor binding; phosphoprotein binding; phosphotyrosine binding; protein binding; protein domain specific |
| ◆ Recombinant Proteins | ||
| GRB2-311C | Recombinant Cynomolgus Monkey GRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GRB2-151H | Recombinant Human GRB2 Protein, DYKDDDDK-tagged | +Inquiry |
| GRB2-28483TH | Recombinant Human GRB2 | +Inquiry |
| GRB2-28345TH | Recombinant Human GRB2, His-tagged | +Inquiry |
| GRB2-5320HF | Recombinant Full Length Human GRB2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GRB2-184HKCL | Human GRB2 Knockdown Cell Lysate | +Inquiry |
| GRB2-5755HCL | Recombinant Human GRB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRB2 Products
Required fields are marked with *
My Review for All GRB2 Products
Required fields are marked with *
