Recombinant Human GTF3A Protein, GST-tagged
Cat.No. : | GTF3A-4461H |
Product Overview : | Human GTF3A partial ORF ( NP_002088, 185 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene is a zinc finger protein with nine Cis[2]-His[2] zinc finger domains. It functions as an RNA polymerase III transcription factor to induce transcription of the 5S rRNA genes. The protein binds to a 50 bp internal promoter in the 5S genes called the internal control region (ICR), and nucleates formation of a stable preinitiation complex. This complex recruits the TFIIIC and TFIIIB transcription factors and RNA polymerase III to form the complete transcription complex. The protein is thought to be translated using a non-AUG translation initiation site in mammals based on sequence analysis, protein homology, and the size of the purified protein. [provided by RefSeq |
Molecular Mass : | 35.64 kDa |
AA Sequence : | NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GTF3A general transcription factor IIIA [ Homo sapiens ] |
Official Symbol | GTF3A |
Synonyms | GTF3A; general transcription factor IIIA; transcription factor IIIA; AP2; TFIIIA; |
Gene ID | 2971 |
mRNA Refseq | NM_002097 |
Protein Refseq | NP_002088 |
MIM | 600860 |
UniProt ID | Q92664 |
◆ Recombinant Proteins | ||
GTF3A-4461H | Recombinant Human GTF3A Protein, GST-tagged | +Inquiry |
GTF3A-7366M | Recombinant Mouse GTF3A Protein | +Inquiry |
Gtf3a-1605M | Recombinant Mouse Gtf3a Protein, His&GST-tagged | +Inquiry |
GTF3A-2400R | Recombinant Rat GTF3A Protein, His (Fc)-Avi-tagged | +Inquiry |
GTF3A-1057H | Recombinant Human GTF3A protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GTF3A Products
Required fields are marked with *
My Review for All GTF3A Products
Required fields are marked with *
0
Inquiry Basket