Recombinant Human HBQ1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HBQ1-450H |
Product Overview : | HBQ1 MS Standard C13 and N15-labeled recombinant protein (NP_005322) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Theta-globin mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue. The theta-1 gene may be expressed very early in embryonic life, perhaps sometime before 5 weeks. Theta-1 is a member of the human alpha-globin gene cluster that involves five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-2 -pseudoalpha-1 - alpha-2 - alpha-1 - theta-1 - 3'. Research supports a transcriptionally active role for the gene and a functional role for the peptide in specific cells, possibly those of early erythroid tissue. |
Molecular Mass : | 15.5 kDa |
AA Sequence : | MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HBQ1 hemoglobin subunit theta 1 [ Homo sapiens (human) ] |
Official Symbol | HBQ1 |
Synonyms | hemoglobin, theta 1; 4833; Ensembl:ENSG00000086506; hemoglobin subunit theta-1;theta-1-globin;hemoglobin theta-1 chain; |
Gene ID | 3049 |
mRNA Refseq | NM_005331 |
Protein Refseq | NP_005322 |
MIM | 142240 |
UniProt ID | P09105 |
◆ Recombinant Proteins | ||
HBQ1-15874H | Recombinant Human HBQ1, His-tagged | +Inquiry |
HBQ1-4607H | Recombinant Human HBQ1 Protein, GST-tagged | +Inquiry |
HBQ1-13686H | Recombinant Human HBQ1 protein, His-tagged | +Inquiry |
HBQ1-6874H | Recombinant Human HBQ1 protein, GST-tagged | +Inquiry |
HBQ1-3499HF | Recombinant Full Length Human HBQ1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBQ1-317HCL | Recombinant Human HBQ1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBQ1 Products
Required fields are marked with *
My Review for All HBQ1 Products
Required fields are marked with *