Recombinant Human HBQ1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HBQ1-450H
• Product Overview: HBQ1 MS Standard C13 and N15-labeled recombinant protein (NP_005322) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Theta-globin mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue. The theta-1 gene may be expressed very early in embryonic life, perhaps sometime before 5 weeks. Theta-1 is a member of the human alpha-globin gene cluster that involves five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-2 -pseudoalpha-1 - alpha-2 - alpha-1 - theta-1 - 3'. Research supports a transcriptionally active role for the gene and a functional role for the peptide in specific cells, possibly those of early erythroid tissue.
• Molecular Mass: 15.5 kDa
• AA Sequence: MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HBQ1 hemoglobin subunit theta 1 [ Homo sapiens (human) ]
• Official Symbol: HBQ1
• Synonyms: hemoglobin, theta 1; 4833; Ensembl:ENSG00000086506; hemoglobin subunit theta-1;theta-1-globin;hemoglobin theta-1 chain
• Gene ID: 3049
• mRNA Refseq: NM_005331
• Protein Refseq: NP_005322
• MIM: 142240
• UniProt ID: P09105