Recombinant Human HDAC1 protein(281-480 aa), C-His-tagged

• Cat.No.: HDAC1-2855H
• Product Overview: Recombinant Human HDAC1 protein(Q13547)(281-480 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 281-480 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: HAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK

Gene Information

• Gene Name: HDAC1 histone deacetylase 1 [ Homo sapiens ]
• Official Symbol: HDAC1
• Synonyms: HDAC1; histone deacetylase 1; RPD3L1; GON 10; HD1; reduced potassium dependency, yeast homolog-like 1; RPD3; GON-10; DKFZp686H12203
• Gene ID: 3065
• mRNA Refseq: NM_004964
• Protein Refseq: NP_004955
• MIM: 601241
• UniProt ID: Q13547