Recombinant Human HDAC1 protein(281-480 aa), C-His-tagged
| Cat.No. : | HDAC1-2855H |
| Product Overview : | Recombinant Human HDAC1 protein(Q13547)(281-480 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 281-480 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | HAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK |
| Gene Name | HDAC1 histone deacetylase 1 [ Homo sapiens ] |
| Official Symbol | HDAC1 |
| Synonyms | HDAC1; histone deacetylase 1; RPD3L1; GON 10; HD1; reduced potassium dependency, yeast homolog-like 1; RPD3; GON-10; DKFZp686H12203; |
| Gene ID | 3065 |
| mRNA Refseq | NM_004964 |
| Protein Refseq | NP_004955 |
| MIM | 601241 |
| UniProt ID | Q13547 |
| ◆ Recombinant Proteins | ||
| HDAC1-13HFL | Recombinant Human HDAC1 Protein, Full Length, C-Flag tagged | +Inquiry |
| HDAC1-1353H | Active Recombinant Human HDAC1, GST-tagged | +Inquiry |
| HDAC1-13703H | Recombinant Human HDAC1 protein, GST-tagged | +Inquiry |
| HDAC1-2507H | Recombinant Human HDAC1 protein, His-tagged | +Inquiry |
| HDAC1-3321H | Recombinant Human HDAC1 Protein (Val183-Ala482), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HDAC1-351HKCL | Human HDAC1 Knockdown Cell Lysate | +Inquiry |
| HDAC1-5608HCL | Recombinant Human HDAC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDAC1 Products
Required fields are marked with *
My Review for All HDAC1 Products
Required fields are marked with *



