Recombinant Human HDAC5 Protein, GST-tagged

Cat.No. : HDAC5-4647H
Product Overview : Human HDAC5 partial ORF ( AAH51824, 330 a.a. - 429 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the class II histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. It coimmunoprecipitates only with HDAC3 family member and might form multicomplex proteins. It also interacts with myocyte enhancer factor-2 (MEF2) proteins, resulting in repression of MEF2-dependent genes. This gene is thought to be associated with colon cancer. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : AENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HDAC5 histone deacetylase 5 [ Homo sapiens ]
Official Symbol HDAC5
Synonyms HDAC5; histone deacetylase 5; FLJ90614; KIAA0600; NY CO 9; antigen NY-CO-9; HD5; NY-CO-9;
Gene ID 10014
mRNA Refseq NM_001015053
Protein Refseq NP_001015053
MIM 605315
UniProt ID Q9UQL6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HDAC5 Products

Required fields are marked with *

My Review for All HDAC5 Products

Required fields are marked with *

0
cart-icon