Recombinant Human HDAC5 Protein, GST-tagged
Cat.No. : | HDAC5-4647H |
Product Overview : | Human HDAC5 partial ORF ( AAH51824, 330 a.a. - 429 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the class II histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. It coimmunoprecipitates only with HDAC3 family member and might form multicomplex proteins. It also interacts with myocyte enhancer factor-2 (MEF2) proteins, resulting in repression of MEF2-dependent genes. This gene is thought to be associated with colon cancer. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | AENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HDAC5 histone deacetylase 5 [ Homo sapiens ] |
Official Symbol | HDAC5 |
Synonyms | HDAC5; histone deacetylase 5; FLJ90614; KIAA0600; NY CO 9; antigen NY-CO-9; HD5; NY-CO-9; |
Gene ID | 10014 |
mRNA Refseq | NM_001015053 |
Protein Refseq | NP_001015053 |
MIM | 605315 |
UniProt ID | Q9UQL6 |
◆ Recombinant Proteins | ||
HDAC5-1358M | Active Recombinant Mouse HDAC5, GST-tagged | +Inquiry |
Hdac5-1593M | Recombinant Mouse Histone Deacetylase 5, GST-tagged | +Inquiry |
HDAC5-4647H | Recombinant Human HDAC5 Protein, GST-tagged | +Inquiry |
HDAC5-28267TH | Recombinant Human HDAC5 protein, GST-tagged | +Inquiry |
HDAC5-312H | Active Recombinant Human HDAC5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDAC5-5604HCL | Recombinant Human HDAC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDAC5 Products
Required fields are marked with *
My Review for All HDAC5 Products
Required fields are marked with *