Recombinant Human HLA-DMB Protein, GST-tagged
| Cat.No. : | HLA-DMB-4837H |
| Product Overview : | Human HLA-DMB partial ORF ( NP_002109, 22 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 22-129 a.a. |
| Description : | HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq |
| Molecular Mass : | 37.62 kDa |
| AA Sequence : | VAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTRE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HLA-DMB major histocompatibility complex, class II, DM beta [ Homo sapiens ] |
| Official Symbol | HLA-DMB |
| Synonyms | HLA-DMB; major histocompatibility complex, class II, DM beta; HLA class II histocompatibility antigen, DM beta chain; D6S221E; RING7; MHC class II HLA-DMB; MHC class II antigen DMB; really interesting new gene 7 protein; MHC class II antigen HLA-DM beta chain; class II histocompatibility antigen, M beta chain; |
| Gene ID | 3109 |
| mRNA Refseq | NM_002118 |
| Protein Refseq | NP_002109 |
| MIM | 142856 |
| UniProt ID | P28068 |
| ◆ Recombinant Proteins | ||
| HLA-DMB-324H | Recombinant Human HLA-DMB Protein, MYC/DDK-tagged | +Inquiry |
| HLA-DMB-6533H | Recombinant Human HLA-DMB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HLA-DMB-4837H | Recombinant Human HLA-DMB Protein, GST-tagged | +Inquiry |
| HLA-DMB-3989H | Recombinant Human HLA-DMB protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HLA-DMB-5500HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-DMB Products
Required fields are marked with *
My Review for All HLA-DMB Products
Required fields are marked with *
