Recombinant Human HLA-DMB Protein, GST-tagged

Cat.No. : HLA-DMB-4837H
Product Overview : Human HLA-DMB partial ORF ( NP_002109, 22 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 22-129 a.a.
Description : HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq
Molecular Mass : 37.62 kDa
AA Sequence : VAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTRE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HLA-DMB major histocompatibility complex, class II, DM beta [ Homo sapiens ]
Official Symbol HLA-DMB
Synonyms HLA-DMB; major histocompatibility complex, class II, DM beta; HLA class II histocompatibility antigen, DM beta chain; D6S221E; RING7; MHC class II HLA-DMB; MHC class II antigen DMB; really interesting new gene 7 protein; MHC class II antigen HLA-DM beta chain; class II histocompatibility antigen, M beta chain;
Gene ID 3109
mRNA Refseq NM_002118
Protein Refseq NP_002109
MIM 142856
UniProt ID P28068

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HLA-DMB Products

Required fields are marked with *

My Review for All HLA-DMB Products

Required fields are marked with *

0
cart-icon
0
compare icon