Recombinant Human HLA-DMB Protein, GST-tagged

• Cat.No.: HLA-DMB-4837H
• Product Overview: Human HLA-DMB partial ORF ( NP_002109, 22 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 22-129 a.a.
• Description: HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq
• Molecular Mass: 37.62 kDa
• AA Sequence: VAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTRE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HLA-DMB major histocompatibility complex, class II, DM beta [ Homo sapiens ]
• Official Symbol: HLA-DMB
• Synonyms: HLA-DMB; major histocompatibility complex, class II, DM beta; HLA class II histocompatibility antigen, DM beta chain; D6S221E; RING7; MHC class II HLA-DMB; MHC class II antigen DMB; really interesting new gene 7 protein; MHC class II antigen HLA-DM beta chain; class II histocompatibility antigen, M beta chain
• Gene ID: 3109
• mRNA Refseq: NM_002118
• Protein Refseq: NP_002109
• MIM: 142856
• UniProt ID: P28068