Recombinant Human HLA-DMB protein, His-tagged
Cat.No. : | HLA-DMB-3989H |
Product Overview : | Recombinant Human HLA-DMB protein(P28068)(19-218aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-218aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.4 kDa |
AA Sequence : | GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HLA-DMB major histocompatibility complex, class II, DM beta [ Homo sapiens ] |
Official Symbol | HLA-DMB |
Synonyms | HLA-DMB; major histocompatibility complex, class II, DM beta; HLA class II histocompatibility antigen, DM beta chain; D6S221E; RING7; MHC class II HLA-DMB; MHC class II antigen DMB; really interesting new gene 7 protein; MHC class II antigen HLA-DM beta chain; class II histocompatibility antigen, M beta chain; |
Gene ID | 3109 |
mRNA Refseq | NM_002118 |
Protein Refseq | NP_002109 |
MIM | 142856 |
UniProt ID | P28068 |
◆ Recombinant Proteins | ||
HLA-DMB-3989H | Recombinant Human HLA-DMB protein, His-tagged | +Inquiry |
HLA-DMB-6533H | Recombinant Human HLA-DMB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HLA-DMB-4837H | Recombinant Human HLA-DMB Protein, GST-tagged | +Inquiry |
HLA-DMB-324H | Recombinant Human HLA-DMB Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DMB-5500HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-DMB Products
Required fields are marked with *
My Review for All HLA-DMB Products
Required fields are marked with *
0
Inquiry Basket