Recombinant Human HSD11B1 protein, His-SUMO-tagged
Cat.No. : | HSD11B1-3054H |
Product Overview : | Recombinant Human HSD11B1 protein(P28845)(25-292aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-292aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.5 kDa |
AA Sequence : | EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HSD11B1 hydroxysteroid (11-beta) dehydrogenase 1 [ Homo sapiens ] |
Official Symbol | HSD11B1 |
Synonyms | HSD11B1; hydroxysteroid (11-beta) dehydrogenase 1; HSD11, HSD11B; corticosteroid 11-beta-dehydrogenase isozyme 1; SDR26C1; short chain dehydrogenase/reductase family 26C; member 1; short chain dehydrogenase/reductase family 26C, member 1; HDL; 11-DH; HSD11; HSD11B; HSD11L; 11-beta-HSD1; MGC13539; |
Gene ID | 3290 |
mRNA Refseq | NM_001206741 |
Protein Refseq | NP_001193670 |
MIM | 600713 |
UniProt ID | P28845 |
◆ Recombinant Proteins | ||
HSD11B1-27736TH | Recombinant Human HSD11B1 | +Inquiry |
Hsd11b1-476R | Recombinant Rat Hsd11b1 Protein, His-tagged | +Inquiry |
HSD11B1-1972R | Recombinant Rhesus Macaque HSD11B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD11B1-065H | Active Recombinant Human HSD11B1 Protein, His-tagged | +Inquiry |
HSD11B1-1099H | Recombinant Human HSD11B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD11B1-5380HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
HSD11B1-5381HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD11B1 Products
Required fields are marked with *
My Review for All HSD11B1 Products
Required fields are marked with *
0
Inquiry Basket