Recombinant Human IGF1R protein, His-tagged
| Cat.No. : | IGF1R-3080H |
| Product Overview : | Recombinant Human IGF1R protein(P08069)(763-931aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 763-931aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 23.4 kDa |
| AA Sequence : | YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | IGF1R insulin-like growth factor 1 receptor [ Homo sapiens ] |
| Official Symbol | IGF1R |
| Synonyms | IGF1R; insulin-like growth factor 1 receptor; CD221; IGFIR; IGFR; JTK13; MGC18216; IGF-I receptor; soluble IGF1R variant 1; soluble IGF1R variant 2; insulin-like growth factor I receptor; MGC142170; MGC142172; |
| Gene ID | 3480 |
| mRNA Refseq | NM_000875 |
| Protein Refseq | NP_000866 |
| MIM | 147370 |
| UniProt ID | P08069 |
| ◆ Recombinant Proteins | ||
| IGF1R-2037R | Recombinant Rhesus Macaque IGF1R Protein, His (Fc)-Avi-tagged | +Inquiry |
| IGF1R-1399C | Recombinant Cynomolgus IGF1R protein, His-tagged | +Inquiry |
| IGF1R-29118TH | Recombinant Human IGF1R | +Inquiry |
| IGF1R-3004R | Recombinant Rat IGF1R Protein | +Inquiry |
| RFL12998RF | Recombinant Full Length Rat Insulin-Like Growth Factor 1 Receptor(Igf1R) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IGF1R-2928HCL | Recombinant Human IGF1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF1R Products
Required fields are marked with *
My Review for All IGF1R Products
Required fields are marked with *
