Recombinant Human IL-32α Protein
Cat.No. : | IL32-173H |
Product Overview : | Recombinant Human IL-32α Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Interleukin 32 alpha (IL-32 α) is one of six known splice variants of the IL-32 gene. IL-32 α induces the macrophage production of inflammatory cytokines, such as interleukin 8 (IL-8), tumor necrosis factor-alpha (TNF-α), and macrophage inflammatory protein 2 (MIP-2). IL-32 α expression is increased after the activation of T cells, natural killer (NK) cells, and interferon gamma-treated epithelial cells. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 14.9 kDa (131 aa) |
AA Sequence : | MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 50 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | IL32 interleukin 32 [ Homo sapiens (human) ] |
Official Symbol | IL32 |
Synonyms | IL32; interleukin 32; interleukin-32; natural killer cell transcript 4; NK4; TAIF; TAIFb; TAIFd; interleukin-32 eta; interleukin-32 small; interleukin-32 theta; natural killer cells protein 4; tumor necrosis factor alpha-inducing factor; TAIFa; TAIFc; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma; |
Gene ID | 9235 |
mRNA Refseq | NM_001012631 |
Protein Refseq | NP_001012649 |
MIM | 606001 |
UniProt ID | P24001 |
◆ Recombinant Proteins | ||
IL32-20H | Recombinant Human IL32 Protein, His tagged | +Inquiry |
IL32-190H | Recombinant Active Human IL32 Protein, His-tagged(C-ter) | +Inquiry |
IL32-5189H | Recombinant Human IL32 Protein, GST-tagged | +Inquiry |
IL32-1678H | Recombinant Human IL32 Protein, His&GST-tagged | +Inquiry |
IL32-314H | Active Recombinant Human IL32 Protein (Met1-Lys131), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL32-2743HCL | Recombinant Human IL32 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL32 Products
Required fields are marked with *
My Review for All IL32 Products
Required fields are marked with *
0
Inquiry Basket