Recombinant Human IL10RB Protein, Fc-His-Avi-tagged, Biotinylated
Cat.No. : | IL10RB-4431HB |
Product Overview : | Recombinant Human IL10RB Protein, fused to Fc-His-Avi-tag, was expressed in HEK293. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Avi&Fc&His |
Description : | The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21. |
Form : | Sterile PBS, pH7.4 |
Molecular Mass : | 50 kDa |
AA Sequence : | MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Endotoxin : | <1EU/ug by LAL |
Purity : | >85% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.323mg/ml by BCA |
Gene Name | IL10RB interleukin 10 receptor subunit beta [ Homo sapiens (human) ] |
Official Symbol | IL10RB |
Synonyms | CRFB4; IBD25; CRF2-4; D21S58; D21S66; CDW210B; IL-10R2; IL-10RB |
Gene ID | 3588 |
mRNA Refseq | NM_000628.5 |
Protein Refseq | NP_000619.3 |
MIM | 123889 |
UniProt ID | Q08334 |
◆ Recombinant Proteins | ||
Il10rb-5181M | Recombinant Mouse Il10rb protein(Met1-Ser222), His-tagged | +Inquiry |
Il10rb-5180M | Recombinant Mouse Il10rb protein, hFc-tagged | +Inquiry |
IL10RB-14142H | Recombinant Human IL10RB, His-tagged | +Inquiry |
IL10RB-3442Z | Recombinant Zebrafish IL10RB | +Inquiry |
Il10rb-1732M | Recombinant Mouse Il10rb protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10RB-1795MCL | Recombinant Mouse IL10RB cell lysate | +Inquiry |
IL10RB-1371RCL | Recombinant Rat IL10RB cell lysate | +Inquiry |
IL10RB-2677HCL | Recombinant Human IL10RB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL10RB Products
Required fields are marked with *
My Review for All IL10RB Products
Required fields are marked with *