Recombinant Human IL10RB Protein, Fc-His-Avi-tagged, Biotinylated

Cat.No. : IL10RB-4431HB
Product Overview : Recombinant Human IL10RB Protein, fused to Fc-His-Avi-tag, was expressed in HEK293.
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Avi&Fc&His
Description : The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21.
Form : Sterile PBS, pH7.4
Molecular Mass : 50 kDa
AA Sequence : MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Endotoxin : <1EU/ug by LAL
Purity : >85% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.323mg/ml by BCA
Gene Name IL10RB interleukin 10 receptor subunit beta [ Homo sapiens (human) ]
Official Symbol IL10RB
Synonyms CRFB4; IBD25; CRF2-4; D21S58; D21S66; CDW210B; IL-10R2; IL-10RB
Gene ID 3588
mRNA Refseq NM_000628.5
Protein Refseq NP_000619.3
MIM 123889
UniProt ID Q08334

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL10RB Products

Required fields are marked with *

My Review for All IL10RB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon