Recombinant Human IL11RA Protein, GST-tagged
Cat.No. : | IL11RA-561H |
Product Overview : | Recombinant Human IL11RA Protien(NP_001136256)(184-361 aa), fused to GST tag, was expressed in E. coli. |
Availability | May 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 184-361 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | GAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | IL11RA interleukin 11 receptor, alpha [ Homo sapiens ] |
Official Symbol | IL11RA |
Synonyms | IL11RA; interleukin 11 receptor, alpha; interleukin-11 receptor subunit alpha; IL-11RA; IL-11R subunit alpha; IL-11 receptor subunit alpha; interleukin-11 receptor alpha chain; CRSDA; MGC2146; |
Gene ID | 3590 |
mRNA Refseq | NM_001142784 |
Protein Refseq | NP_001136256 |
MIM | 600939 |
UniProt ID | Q14626 |
◆ Recombinant Proteins | ||
IL11RA-0195H | Active Recombinant Human IL11RA protein, His-tagged | +Inquiry |
IL11RA-174C | Recombinant Canine IL11RA, LEVLFQ tagged | +Inquiry |
IL11RA-561H | Recombinant Human IL11RA Protein, GST-tagged | +Inquiry |
Il11ra1-2294M | Recombinant Mouse IL11RA protein(Met1-Gln367), His-tagged | +Inquiry |
IL11RA-3466C | Recombinant Chicken IL11RA | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL11RA-2389HCL | Recombinant Human IL11RA cell lysate | +Inquiry |
IL11RA-2558MCL | Recombinant Mouse IL11RA cell lysate | +Inquiry |
IL11RA-001CCL | Recombinant Canine IL11RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL11RA Products
Required fields are marked with *
My Review for All IL11RA Products
Required fields are marked with *
0
Inquiry Basket