Recombinant Human IL11RA Protein, GST-tagged

Cat.No. : IL11RA-561H
Product Overview : Recombinant Human IL11RA Protien(NP_001136256)(184-361 aa), fused to GST tag, was expressed in E. coli.
Availability May 09, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 184-361 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : GAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRD
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name IL11RA interleukin 11 receptor, alpha [ Homo sapiens ]
Official Symbol IL11RA
Synonyms IL11RA; interleukin 11 receptor, alpha; interleukin-11 receptor subunit alpha; IL-11RA; IL-11R subunit alpha; IL-11 receptor subunit alpha; interleukin-11 receptor alpha chain; CRSDA; MGC2146;
Gene ID 3590
mRNA Refseq NM_001142784
Protein Refseq NP_001136256
MIM 600939
UniProt ID Q14626

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL11RA Products

Required fields are marked with *

My Review for All IL11RA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon