Recombinant Human IL13 Protein, His-tagged

Cat.No. : IL13-120H
Product Overview : Recombinant Human Interleukin-13 is produced by our Mammalian expression system and the target gene encoding Leu25-Asn146 is expressed with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : His
Protein Length : Leu25-Asn146
Description : Interleukin-13 is also known as IL-13. It is a protein that in humans is encoded by the IL13 gene. Interleukin-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells.It is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils.
Form : Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
AA Sequence : LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIE KTQRMLSGFCPHKVS AGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFNVDHHHHHH
Endotoxin : Less than 0.1 ng/ug (1 EU/ug).
Purity : >95%
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100μg/ml.
Dissolve the lyophilized protein in distilled water.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Quality Statement : Purity: Greater than 95% as determined by reducing SDS-PAGE.
Shipping : The product is shipped at ambient temperature.
Upon receipt, store it immediately at the temperature listed below.
Gene Name IL13 interleukin 13 [ Homo sapiens (human) ]
Official Symbol IL13
Synonyms Interleukin-13; IL-13; P600
Gene ID 3596
mRNA Refseq NM_001354991.2
Protein Refseq NP_001341920.1
MIM 147683
UniProt ID P35225

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL13 Products

Required fields are marked with *

My Review for All IL13 Products

Required fields are marked with *

0
cart-icon