Recombinant Human IL13 Protein, His-tagged
| Cat.No. : | IL13-120H |
| Product Overview : | Recombinant Human Interleukin-13 is produced by our Mammalian expression system and the target gene encoding Leu25-Asn146 is expressed with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | His |
| Protein Length : | Leu25-Asn146 |
| Description : | Interleukin-13 is also known as IL-13. It is a protein that in humans is encoded by the IL13 gene. Interleukin-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells.It is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. |
| Form : | Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. |
| AA Sequence : | LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIE KTQRMLSGFCPHKVS AGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFNVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
| Purity : | >95% |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
| Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
| Gene Name | IL13 interleukin 13 [ Homo sapiens (human) ] |
| Official Symbol | IL13 |
| Synonyms | Interleukin-13; IL-13; P600 |
| Gene ID | 3596 |
| mRNA Refseq | NM_001354991.2 |
| Protein Refseq | NP_001341920.1 |
| MIM | 147683 |
| UniProt ID | P35225 |
| ◆ Recombinant Proteins | ||
| IL13-22H | Recombinant Human IL13 protein | +Inquiry |
| IL13-4154C | Recombinant Chicken IL13 | +Inquiry |
| IL13-519HB | Recombinant Human IL13 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| IL13-248H | Recombinant Human interleukin 13 Protein, Tag Free | +Inquiry |
| Il13-16M | Active Recombinant Mouse Il13 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
| IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
| IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
| IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL13 Products
Required fields are marked with *
My Review for All IL13 Products
Required fields are marked with *



