Recombinant Human IL13 Protein, His-tagged
Cat.No. : | IL13-120H |
Product Overview : | Recombinant Human Interleukin-13 is produced by our Mammalian expression system and the target gene encoding Leu25-Asn146 is expressed with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His |
Protein Length : | Leu25-Asn146 |
Description : | Interleukin-13 is also known as IL-13. It is a protein that in humans is encoded by the IL13 gene. Interleukin-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells.It is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. |
Form : | Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. |
AA Sequence : | LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIE KTQRMLSGFCPHKVS AGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFNVDHHHHHH |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | IL13 interleukin 13 [ Homo sapiens (human) ] |
Official Symbol | IL13 |
Synonyms | Interleukin-13; IL-13; P600 |
Gene ID | 3596 |
mRNA Refseq | NM_001354991.2 |
Protein Refseq | NP_001341920.1 |
MIM | 147683 |
UniProt ID | P35225 |
◆ Recombinant Proteins | ||
IL13-234B | Active Recombinant Bovine Interleukin 13 | +Inquiry |
Il13-49M | Active Recombinant Mouse Il13 Protein (Pro22-Fhe131), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Il13-256I | Active Recombinant Mouse Il13 Protein, His-tagged | +Inquiry |
IL13-1985P | Recombinant Pig IL13 protein | +Inquiry |
IL13-4307H | Recombinant Human IL13 Protein (Gly35-Asn146), C-Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL13 Products
Required fields are marked with *
My Review for All IL13 Products
Required fields are marked with *