Recombinant Human IL17A Protein, GST-tagged
| Cat.No. : | IL17A-57H |
| Product Overview : | Recombinant Human IL17A Protein, fused to GST-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Description : | This gene is a member of the IL-17 receptor family which includes five members (IL-17RA-E) and the encoded protein is a proinflammatory cytokine produced by activated T cells. IL-17A-mediated downstream pathways induce the production of inflammatory molecules, chemokines, antimicrobial peptides, and remodeling proteins. The encoded protein elicits crucial impacts on host defense, cell trafficking, immune modulation, and tissue repair, with a key role in the induction of innate immune defenses. This cytokine stimulates non-hematopoietic cells and promotes chemokine production thereby attracting myeloid cells to inflammatory sites. This cytokine also regulates the activities of NF-kappaB and mitogen-activated protein kinases and can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). IL-17A plays a pivotal role in various infectious diseases, inflammatory and autoimmune disorders, and cancer. High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. |
| Form : | Supplied as a 0.2 μm filtered solution in PBS (pH8.0). |
| Molecular Mass : | ~40 kDa |
| AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAAAAS |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.13 mg/ml |
| Gene Name | IL17A interleukin 17A [ Homo sapiens (human) ] |
| Official Symbol | IL17A |
| Synonyms | IL17; CTLA8; IL-17; ILA17; CTLA-8; IL-17A |
| Gene ID | 3605 |
| mRNA Refseq | NM_002190 |
| Protein Refseq | NP_002181 |
| MIM | 603149 |
| UniProt ID | Q16552 |
| ◆ Recombinant Proteins | ||
| IL17A-122H | Recombinant Human IL17A protein | +Inquiry |
| IL17A-97H | Recombinant Human IL-17A | +Inquiry |
| IL17A-425M | Active Recombinant Marmoset IL17A protein | +Inquiry |
| IL17A-141R | Recombinant Rat IL17A Protein | +Inquiry |
| IL17A-168C | Active Recombinant Canine IL17A protein(Gly26-Ala155) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
