Recombinant Human IL17D protein, GST-tagged

Cat.No. : IL17D-28H
Product Overview : Recombinant human IL-17D is a 40.5 kDa disulfide-linked homodimer of two 185 amino acid polypeptide chains
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Form : Storage Buffer PBS pH 7.4.
AA Sequence : APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVS PWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVG CTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
Purity : >95 % as determined by SDS-PAGE analysis
Applications : Useful in Western Blot and ELISA. This protein has not been tested for any functionality.
Storage : Store at -80 Centidegree. Avoid freeze-thaw cycles.
Gene Name IL17D interleukin 17D [ Homo sapiens ]
Official Symbol IL17D
Synonyms IL17D; interleukin 17D; interleukin-17D; FLJ30846; IL 17D; IL 22; IL 27; IL27; interleukin 27; interleukin-27; IL-22; IL-27; IL-17D;
Gene ID 53342
mRNA Refseq NM_138284
Protein Refseq NP_612141
MIM 607587
UniProt ID Q8TAD2
Chromosome Location 13q11
Function cytokine activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL17D Products

Required fields are marked with *

My Review for All IL17D Products

Required fields are marked with *

0

Inquiry Basket

cartIcon