Recombinant Human IL17D protein, GST-tagged IL17D-28H

Cat.No. :	IL17D-28H
Product Overview :	Recombinant human IL-17D is a 40.5 kDa disulfide-linked homodimer of two 185 amino acid polypeptide chains
Source :	E. coli
Species :	Human
Tag :	GST
Form :	Storage Buffer PBS pH 7.4.
AA Sequence :	APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVS PWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVG CTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
Purity :	>95 % as determined by SDS-PAGE analysis
Applications :	Useful in Western Blot and ELISA. This protein has not been tested for any functionality.
Storage :	Store at -80 Centidegree. Avoid freeze-thaw cycles.

Download Datasheet

Gene Name :	IL17D interleukin 17D [ Homo sapiens ]
Official Symbol :	IL17D
Synonyms :	IL17D; interleukin 17D; interleukin-17D; FLJ30846; IL 17D; IL 22; IL 27; IL27; interleukin 27; interleukin-27; IL-22; IL-27; IL-17D;
Gene ID :	53342
mRNA Refseq :	NM_138284
Protein Refseq :	NP_612141
MIM :	607587
UniProt ID :	Q8TAD2
Chromosome Location :	13q11
Function :	cytokine activity;