Recombinant Human IL17D protein, GST-tagged

• Cat.No.: IL17D-28H
• Product Overview: Recombinant human IL-17D is a 40.5 kDa disulfide-linked homodimer of two 185 amino acid polypeptide chains

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Form: Storage Buffer PBS pH 7.4.
• AA Sequence: APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVS PWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVG CTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
• Purity: >95 % as determined by SDS-PAGE analysis
• Applications: Useful in Western Blot and ELISA. This protein has not been tested for any functionality.
• Storage: Store at -80 Centidegree. Avoid freeze-thaw cycles.

Gene Information

• Gene Name: IL17D interleukin 17D [ Homo sapiens ]
• Official Symbol: IL17D
• Synonyms: IL17D; interleukin 17D; interleukin-17D; FLJ30846; IL 17D; IL 22; IL 27; IL27; interleukin 27; interleukin-27; IL-22; IL-27; IL-17D
• Gene ID: 53342
• mRNA Refseq: NM_138284
• Protein Refseq: NP_612141
• MIM: 607587
• UniProt ID: Q8TAD2
• Chromosome Location: 13q11
• Function: cytokine activity