"IL17D" Related Products

Expand
Expand

Recombinant Human IL17D protein, GST-tagged

Cat.No. : IL17D-28H
Product Overview : Recombinant human IL-17D is a 40.5 kDa disulfide-linked homodimer of two 185 amino acid polypeptide chains
Source : E. coli
Species : Human
Tag : GST
Form : Storage Buffer PBS pH 7.4.
AA Sequence : APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVS PWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVG CTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
Purity : >95 % as determined by SDS-PAGE analysis
Applications : Useful in Western Blot and ELISA. This protein has not been tested for any functionality.
Storage : Store at -80 Centidegree. Avoid freeze-thaw cycles.
Gene Name : IL17D interleukin 17D [ Homo sapiens ]
Official Symbol : IL17D
Synonyms : IL17D; interleukin 17D; interleukin-17D; FLJ30846; IL 17D; IL 22; IL 27; IL27; interleukin 27; interleukin-27; IL-22; IL-27; IL-17D;
Gene ID : 53342
mRNA Refseq : NM_138284
Protein Refseq : NP_612141
MIM : 607587
UniProt ID : Q8TAD2
Chromosome Location : 13q11
Function : cytokine activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.