Recombinant Human IL17D protein, GST-tagged
Cat.No. : | IL17D-28H |
Product Overview : | Recombinant human IL-17D is a 40.5 kDa disulfide-linked homodimer of two 185 amino acid polypeptide chains |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Form : | Storage Buffer PBS pH 7.4. |
AA Sequence : | APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVS PWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVG CTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP |
Purity : | >95 % as determined by SDS-PAGE analysis |
Applications : | Useful in Western Blot and ELISA. This protein has not been tested for any functionality. |
Storage : | Store at -80 Centidegree. Avoid freeze-thaw cycles. |
Gene Name | IL17D interleukin 17D [ Homo sapiens ] |
Official Symbol | IL17D |
Synonyms | IL17D; interleukin 17D; interleukin-17D; FLJ30846; IL 17D; IL 22; IL 27; IL27; interleukin 27; interleukin-27; IL-22; IL-27; IL-17D; |
Gene ID | 53342 |
mRNA Refseq | NM_138284 |
Protein Refseq | NP_612141 |
MIM | 607587 |
UniProt ID | Q8TAD2 |
Chromosome Location | 13q11 |
Function | cytokine activity; |
◆ Recombinant Proteins | ||
IL17D-14155H | Recombinant Human IL17D, GST-tagged | +Inquiry |
IL17D-28H | Recombinant Human IL17D protein, GST-tagged | +Inquiry |
IL17D-7978H | Active Recombinant Human IL17D protein, His-GST-tagged | +Inquiry |
IL17D-167H | Recombinant Human Interleukin 17D | +Inquiry |
IL17D-2924Z | Recombinant Zebrafish IL17D | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17D-852HCL | Recombinant Human IL17D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17D Products
Required fields are marked with *
My Review for All IL17D Products
Required fields are marked with *