Recombinant Human IL17D protein, GST-tagged
| Cat.No. : | IL17D-28H |
| Product Overview : | Recombinant human IL-17D is a 40.5 kDa disulfide-linked homodimer of two 185 amino acid polypeptide chains |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Form : | Storage Buffer PBS pH 7.4. |
| AA Sequence : | APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVS PWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVG CTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP |
| Purity : | >95 % as determined by SDS-PAGE analysis |
| Applications : | Useful in Western Blot and ELISA. This protein has not been tested for any functionality. |
| Storage : | Store at -80 Centidegree. Avoid freeze-thaw cycles. |
| Gene Name | IL17D interleukin 17D [ Homo sapiens ] |
| Official Symbol | IL17D |
| Synonyms | IL17D; interleukin 17D; interleukin-17D; FLJ30846; IL 17D; IL 22; IL 27; IL27; interleukin 27; interleukin-27; IL-22; IL-27; IL-17D; |
| Gene ID | 53342 |
| mRNA Refseq | NM_138284 |
| Protein Refseq | NP_612141 |
| MIM | 607587 |
| UniProt ID | Q8TAD2 |
| Chromosome Location | 13q11 |
| Function | cytokine activity; |
| ◆ Recombinant Proteins | ||
| Il17d-1664M | Recombinant Mouse Il17d Protein, His-tagged | +Inquiry |
| Il17d-645M | Active Recombinant Mouse Interleukin 17D | +Inquiry |
| IL17D-3659H | Recombinant Human IL17D Protein (Ala18-Pro202), N-His tagged | +Inquiry |
| IL17D-28H | Recombinant Human IL17D protein, GST-tagged | +Inquiry |
| IL17D-248H | Recombinant Human IL17D Protein (Ala18-Pro202), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL17D-852HCL | Recombinant Human IL17D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17D Products
Required fields are marked with *
My Review for All IL17D Products
Required fields are marked with *



