Recombinant Human IL19 protein, His-tagged

• Cat.No.: IL19-14165H
• Product Overview: Recombinant Human IL19 protein(1-177 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-177 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: MCTEGAFPHRSACSLPLTHVHTHIHVCVPVLWGSVPRGMKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRV
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: IL19 interleukin 19 [ Homo sapiens ]
• Official Symbol: IL19
• Synonyms: IL19; interleukin 19; interleukin-19; IL 10C; IL 19; MDA1; melanoma differentiation associated protein like protein; NG.1; ZMDA1; melanoma differentiation associated protein-like protein; melanoma differentiation-associated protein-like protein; IL-10C
• Gene ID: 29949
• mRNA Refseq: NM_013371
• Protein Refseq: NP_037503
• MIM: 605687
• UniProt ID: Q9UHD0