Recombinant Human IL19 protein, His-tagged
Cat.No. : | IL19-14165H |
Product Overview : | Recombinant Human IL19 protein(1-177 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | June 05, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-177 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AASequence : | MCTEGAFPHRSACSLPLTHVHTHIHVCVPVLWGSVPRGMKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | IL19 interleukin 19 [ Homo sapiens ] |
Official Symbol | IL19 |
Synonyms | IL19; interleukin 19; interleukin-19; IL 10C; IL 19; MDA1; melanoma differentiation associated protein like protein; NG.1; ZMDA1; melanoma differentiation associated protein-like protein; melanoma differentiation-associated protein-like protein; IL-10C; |
Gene ID | 29949 |
mRNA Refseq | NM_013371 |
Protein Refseq | NP_037503 |
MIM | 605687 |
UniProt ID | Q9UHD0 |
◆ Recombinant Proteins | ||
Il19-1016R | Recombinant Rat Il19 Protein, His-tagged | +Inquiry |
Il19-150M | Active Recombinant Mouse Il19 Protein (Leu25-Ala176), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL19-03H | Recombinant Human IL19 Protein, His-tagged | +Inquiry |
IL19-3497H | Recombinant Human IL19 Protein (Leu25-Ala177), N-His tagged | +Inquiry |
Il19-01M | Active Recombinant Mouse Il19 Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL19-5242HCL | Recombinant Human IL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL19 Products
Required fields are marked with *
My Review for All IL19 Products
Required fields are marked with *
0
Inquiry Basket