Recombinant Human IL20 protein

Cat.No. : IL20-278H
Product Overview : Recombinant Human IL20 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 153
Description : Human Interleukin-20 (IL-20) is encoded by the IL20 gene located on the chromosome 1 and belongs to the IL-10 family that including IL-10, IL-19, IL-22, IL-24, and IL-26. It is secreted by activated keratinocytes and monocytes, and signals through two distinct cell-surface receptor complexes on keratinocytes and other epithelial cells. IL-20 has functions of regulating proliferation and differentiation of keratinocytes during inflammation, and causing cell expansion of multipotential hematopoietic progenitor cells.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.2, with trehalose.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 17.6 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
AA Sequence : MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Endotoxin : Less than 1 EU/µg of rHuIL-20 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IL20
Official Symbol IL20
Synonyms IL20; interleukin 20; interleukin-20; IL 20; IL10D; ZCYTO10; cytokine Zcyto10; four alpha helix cytokine; IL-20; MGC96907;
Gene ID 50604
mRNA Refseq NM_018724
Protein Refseq NP_061194
MIM 605619
UniProt ID Q9NYY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL20 Products

Required fields are marked with *

My Review for All IL20 Products

Required fields are marked with *

0
cart-icon