Recombinant Human IL20 Protein
| Cat.No. : | IL20-160H |
| Product Overview : | Recombinant Human IL20 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | Interleukin 20 (IL-20) is structurally related to interleukin 10 (IL-10) and is produced by keratinocytes and monocytes. IL-20 acts through the STAT3 signaling pathway to regulate the proliferation of keratinocytes during epidermal inflammation. |
| Bio-activity : | No biological activity data is available at this time. |
| Molecular Mass : | Dimer, 17.7/35.3 kDa (153/306 aa) |
| AA Sequence : | MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 20 mM sodium chloride, pH 7.5 |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | IL20 interleukin 20 [ Homo sapiens (human) ] |
| Official Symbol | IL20 |
| Synonyms | IL20; interleukin 20; interleukin-20; IL 20; IL10D; ZCYTO10; cytokine Zcyto10; four alpha helix cytokine; IL-20; MGC96907; |
| Gene ID | 50604 |
| mRNA Refseq | NM_018724 |
| Protein Refseq | NP_061194 |
| MIM | 605619 |
| UniProt ID | Q9NYY1 |
| ◆ Recombinant Proteins | ||
| IL20-278H | Recombinant Human IL20 protein | +Inquiry |
| Il20-1671M | Recombinant Mouse Il20 Protein, His-tagged | +Inquiry |
| IL20-1818M | Recombinant Mouse IL20 Protein | +Inquiry |
| IL20-1033R | Recombinant Rat IL20 protein(Leu25-Leu176) | +Inquiry |
| IL20-29777TH | Recombinant Human IL20, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL20-5233HCL | Recombinant Human IL20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL20 Products
Required fields are marked with *
My Review for All IL20 Products
Required fields are marked with *
