Recombinant Human IL20 Protein

Cat.No. : IL20-160H
Product Overview : Recombinant Human IL20 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Interleukin 20 (IL-20) is structurally related to interleukin 10 (IL-10) and is produced by keratinocytes and monocytes. IL-20 acts through the STAT3 signaling pathway to regulate the proliferation of keratinocytes during epidermal inflammation.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Dimer, 17.7/35.3 kDa (153/306 aa)
AA Sequence : MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 20 mM sodium chloride, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IL20 interleukin 20 [ Homo sapiens (human) ]
Official Symbol IL20
Synonyms IL20; interleukin 20; interleukin-20; IL 20; IL10D; ZCYTO10; cytokine Zcyto10; four alpha helix cytokine; IL-20; MGC96907;
Gene ID 50604
mRNA Refseq NM_018724
Protein Refseq NP_061194
MIM 605619
UniProt ID Q9NYY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL20 Products

Required fields are marked with *

My Review for All IL20 Products

Required fields are marked with *

0
cart-icon