Recombinant Human IL3 protein(41-130 aa), N-MBP & C-His-tagged

Cat.No. : IL3-2601H
Product Overview : Recombinant Human IL3 protein(P08700)(41-130 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&MBP
Protein Length : 41-130 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : EIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKL
Gene Name IL3 interleukin 3 (colony-stimulating factor, multiple) [ Homo sapiens ]
Official Symbol IL3
Synonyms IL3; interleukin 3 (colony-stimulating factor, multiple); interleukin-3; hematopoietic growth factor; IL 3; mast cell growth factor; MCGF; MGC79398; MGC79399; MULTI CSF; multilineage colony stimulating factor; P cell stimulating factor; mast-cell growth factor; P-cell stimulating factor; P-cell-stimulating factor; multilineage-colony-stimulating factor; multipotential colony-stimulating factor; IL-3; MULTI-CSF;
Gene ID 3562
mRNA Refseq NM_000588
Protein Refseq NP_000579
MIM 147740
UniProt ID P08700

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL3 Products

Required fields are marked with *

My Review for All IL3 Products

Required fields are marked with *

0
cart-icon
0
compare icon