Recombinant Human IL32 protein, His-sumostar-tagged
Cat.No. : | IL32-4328H |
Product Overview : | Recombinant Human IL32 protein(P24001)(31-234aa), fused to N-terminal His tag and sumostar tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His&SUMO |
Protein Length : | 31-234aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.5 kDa |
AA Sequence : | AWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | IL32 interleukin 32 [ Homo sapiens ] |
Official Symbol | IL32 |
Synonyms | IL32; interleukin 32; interleukin-32; natural killer cell transcript 4; NK4; TAIF; TAIFb; TAIFd; interleukin-32 eta; interleukin-32 small; interleukin-32 theta; natural killer cells protein 4; tumor necrosis factor alpha-inducing factor; TAIFa; TAIFc; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma; |
Gene ID | 9235 |
mRNA Refseq | NM_001012631 |
Protein Refseq | NP_001012649 |
MIM | 606001 |
UniProt ID | P24001 |
◆ Recombinant Proteins | ||
IL32-173H | Recombinant Human IL-32α Protein | +Inquiry |
IL32-156H | Recombinant Human IL32 protein(Met1-Lys131), His-tagged | +Inquiry |
IL32-1678H | Recombinant Human IL32 Protein, His&GST-tagged | +Inquiry |
IL32-00H | Active Recombinant Human IL32 Protein, His-tagged | +Inquiry |
IL32-5300H | Recombinant Human IL32 Protein (Met1-Lys234), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL32-2743HCL | Recombinant Human IL32 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL32 Products
Required fields are marked with *
My Review for All IL32 Products
Required fields are marked with *