Recombinant Human IL32 protein, His-sumostar-tagged

• Cat.No.: IL32-4328H
• Product Overview: Recombinant Human IL32 protein(P24001)(31-234aa), fused to N-terminal His tag and sumostar tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His&SUMO
• Protein Length: 31-234aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.5 kDa
• AA Sequence: AWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: IL32 interleukin 32 [ Homo sapiens ]
• Official Symbol: IL32
• Synonyms: IL32; interleukin 32; interleukin-32; natural killer cell transcript 4; NK4; TAIF; TAIFb; TAIFd; interleukin-32 eta; interleukin-32 small; interleukin-32 theta; natural killer cells protein 4; tumor necrosis factor alpha-inducing factor; TAIFa; TAIFc; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma
• Gene ID: 9235
• mRNA Refseq: NM_001012631
• Protein Refseq: NP_001012649
• MIM: 606001
• UniProt ID: P24001