Recombinant Human IL32 protein, His-sumostar-tagged

Cat.No. : IL32-4328H
Product Overview : Recombinant Human IL32 protein(P24001)(31-234aa), fused to N-terminal His tag and sumostar tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His&SUMO
Protein Length : 31-234aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.5 kDa
AA Sequence : AWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name IL32 interleukin 32 [ Homo sapiens ]
Official Symbol IL32
Synonyms IL32; interleukin 32; interleukin-32; natural killer cell transcript 4; NK4; TAIF; TAIFb; TAIFd; interleukin-32 eta; interleukin-32 small; interleukin-32 theta; natural killer cells protein 4; tumor necrosis factor alpha-inducing factor; TAIFa; TAIFc; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma;
Gene ID 9235
mRNA Refseq NM_001012631
Protein Refseq NP_001012649
MIM 606001
UniProt ID P24001

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL32 Products

Required fields are marked with *

My Review for All IL32 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon