Active Recombinant Human IL33 protein, His-tagged

• Cat.No.: IL33-310H
• Product Overview: Active Recombinant Human IL33 protein(NP_254274.1)(His109-Thr270) is expressed from HEK293 with His tag at the N-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 109-270 aa
• Form: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4).
• Bio-activity: Immobilized Human IL-1RL1, hFc Tag at 1μg/ml (100μl/well) on the plate. Dose response curve for Human IL-33, His Tag with the EC50 of 1.93μg/ml determined by ELISA.
• Molecular Mass: The protein has a predicted MW of 19.43 kDa. Due to glycosylation, the protein migrates to 26-30 kDa based on Bis-Tris PAGE result.
• Endotoxin: Less than 1 EU per μg by the LAL method.
• Purity: > 95% as determined by Bis-Tris PAGE > 90% as determined by HPLC
• Storage: -20 to -80°C for 12 months as supplied from date of receipt. -80°C for 3 months after reconstitution. Recommend to aliquot the protein into smaller quantities for optimal storage. Please minimize freeze-thaw cycles.
• Reconstitution: Dissolve the lyophilized protein in distilled water.

Gene Information

• Gene Name: IL33 interleukin 33 [ Homo sapiens ]
• Official Symbol: IL33
• Synonyms: IL33; interleukin 33; C9orf26, chromosome 9 open reading frame 26 (NF HEV); interleukin-33; DKFZp586H0523; DVS27; DVS27 related protein; IL1F11; interleukin 1 family; member 11; NF HEV; nuclear factor for high endothelial venules; IL-33; IL-1F11; DVS27-related protein; interleukin-1 family member 11; nuclear factor from high endothelial venules; NF-HEV; NFEHEV; C9orf26; RP11-575C20.2
• Gene ID: 90865
• mRNA Refseq: NM_001199640
• Protein Refseq: NP_001186569
• MIM: 608678
• UniProt ID: O95760

Q&As

Can you please provide me the AA sequence of this protein?

IL33-310H: HHHHHHHHHHGGGSGGGS-HDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET