Recombinant Human IL36A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : IL36A-3232H
Product Overview : IL1F6 MS Standard C13 and N15-labeled recombinant protein (NP_055255) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients.
Molecular Mass : 17.7 kDa
AA Sequence : MEKALKIDTPQRGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name IL36A interleukin 36 alpha [ Homo sapiens (human) ]
Official Symbol IL36A
Synonyms IL36A; interleukin 36, alpha; IL1F6, interleukin 1 family, member 6 (epsilon); interleukin-36 alpha; FIL1; FIL1E; IL 1F6; IL1(EPSILON); MGC129552; MGC129553; FIL1 epsilon; IL-1 epsilon; interleukin-1 epsilon; IL-1F6 (FIL-1-epsilon); interleukin 1, epsilon; interleukin-1 family member 6; interleukin 1 family, member 6 (epsilon); IL1F6; IL-1F6; FIL1(EPSILON);
Gene ID 27179
mRNA Refseq NM_014440
Protein Refseq NP_055255
MIM 605509
UniProt ID Q9UHA7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL36A Products

Required fields are marked with *

My Review for All IL36A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon