Recombinant Human IRAK1
Cat.No. : | IRAK1-27502TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 530-693 of Human IRAK with an N terminal proprietary tag; Predicted MWt 43.45 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation of the transcription factor NF-kappa B. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 164 amino acids |
Molecular Weight : | 43.450kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Isoform 1 and isoform 2 are ubiquitously expressed in all tissues examined, with isoform 1 being more strongly expressed than isoform 2. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVES DESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGE SSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQK MVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESD EFQS |
Sequence Similarities : | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily.Contains 1 protein kinase domain. |
Tag : | Non |
Gene Name : | IRAK1 interleukin-1 receptor-associated kinase 1 [ Homo sapiens ] |
Official Symbol : | IRAK1 |
Synonyms : | IRAK1; interleukin-1 receptor-associated kinase 1; IRAK; pelle; |
Gene ID : | 3654 |
mRNA Refseq : | NM_001569 |
Protein Refseq : | NP_001560 |
MIM : | 300283 |
Uniprot ID : | P51617 |
Chromosome Location : | Xq28 |
Pathway : | Activated TLR4 signalling, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; |
Function : | ATP binding; NF-kappaB-inducing kinase activity; interleukin-1 receptor binding; kinase activity; nucleotide binding; |
Products Types
◆ Recombinant Protein | ||
IRAK1-5056H | Recombinant Human IRAK1 Protein, GST-tagged | +Inquiry |
IRAK1-5436H | Recombinant Human Interleukin-1 Receptor-Associated Kinase 1, GST-tagged | +Inquiry |
IRAK1-799H | Recombinant Human IRAK1 Protein, GST/His-tagged | +Inquiry |
IRAK1-1170H | Recombinant Human IRAK1 Protein (R194-S712), Tag Free | +Inquiry |
IRAK1-869H | Recombinant Human IRAK1 protein, His-tagged | +Inquiry |
◆ Lysates | ||
IRAK1-5174HCL | Recombinant Human IRAK1 293 Cell Lysate | +Inquiry |
IRAK1-5173HCL | Recombinant Human IRAK1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Customer Reviews (3)
Write a reviewThe IRAK1 protein stands out for its exceptional quality, making it an excellent choice to meet my experimental requirements.
The IRAK1 protein's compatibility with various experimental techniques adds to its versatility.
Its stability and compatibility make it an excellent tool for visualizing and characterizing protein structures at high resolution.
Q&As (5)
Ask a questionYes, there are several clinical trials exploring the inhibition of IRAK1 as a therapeutic strategy for various types of cancer.
IRAK1 is involved in the signaling pathways that can lead to the development of autoimmune diseases by regulating the immune system's response to self-antigens.
Elevated levels of IRAK1 expression have been observed in inflammatory diseases, suggesting its involvement in the dysregulation of inflammatory responses.
Inhibiting IRAK1 activity is being investigated as a potential therapeutic approach for managing inflammatory conditions, offering a target for drug development.
IRAK1 has been identified as a potential target for cancer therapy, as it plays a role in promoting tumor growth and evasion of the immune system.
Ask a Question for All IRAK1 Products
Required fields are marked with *
My Review for All IRAK1 Products
Required fields are marked with *
Inquiry Basket