Recombinant Human IRAK1
| Cat.No. : | IRAK1-27502TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 530-693 of Human IRAK with an N terminal proprietary tag; Predicted MWt 43.45 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 164 amino acids |
| Description : | This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation of the transcription factor NF-kappa B. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 43.450kDa inclusive of tags |
| Tissue specificity : | Isoform 1 and isoform 2 are ubiquitously expressed in all tissues examined, with isoform 1 being more strongly expressed than isoform 2. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVES DESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGE SSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQK MVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESD EFQS |
| Sequence Similarities : | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily.Contains 1 protein kinase domain. |
| Gene Name | IRAK1 interleukin-1 receptor-associated kinase 1 [ Homo sapiens ] |
| Official Symbol | IRAK1 |
| Synonyms | IRAK1; interleukin-1 receptor-associated kinase 1; IRAK; pelle; |
| Gene ID | 3654 |
| mRNA Refseq | NM_001569 |
| Protein Refseq | NP_001560 |
| MIM | 300283 |
| Uniprot ID | P51617 |
| Chromosome Location | Xq28 |
| Pathway | Activated TLR4 signalling, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; |
| Function | ATP binding; NF-kappaB-inducing kinase activity; interleukin-1 receptor binding; kinase activity; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| IRAK1-27500TH | Recombinant Human IRAK1 | +Inquiry |
| IRAK1-2647H | Recombinant Human IRAK1 Protein (Phe212-Leu434), N-His tagged | +Inquiry |
| IRAK1-1542H | Recombinant Human IRAK1 Protein, His tagged | +Inquiry |
| Irak1-1243M | Recombinant Mouse Irak1 Protein, MYC/DDK-tagged | +Inquiry |
| IRAK1-27502TH | Recombinant Human IRAK1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IRAK1-5174HCL | Recombinant Human IRAK1 293 Cell Lysate | +Inquiry |
| IRAK1-5173HCL | Recombinant Human IRAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRAK1 Products
Required fields are marked with *
My Review for All IRAK1 Products
Required fields are marked with *




