Recombinant Human IRAK1
Cat.No. : | IRAK1-27502TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 530-693 of Human IRAK with an N terminal proprietary tag; Predicted MWt 43.45 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 164 amino acids |
Description : | This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation of the transcription factor NF-kappa B. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 43.450kDa inclusive of tags |
Tissue specificity : | Isoform 1 and isoform 2 are ubiquitously expressed in all tissues examined, with isoform 1 being more strongly expressed than isoform 2. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVES DESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGE SSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQK MVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESD EFQS |
Sequence Similarities : | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily.Contains 1 protein kinase domain. |
Gene Name | IRAK1 interleukin-1 receptor-associated kinase 1 [ Homo sapiens ] |
Official Symbol | IRAK1 |
Synonyms | IRAK1; interleukin-1 receptor-associated kinase 1; IRAK; pelle; |
Gene ID | 3654 |
mRNA Refseq | NM_001569 |
Protein Refseq | NP_001560 |
MIM | 300283 |
Uniprot ID | P51617 |
Chromosome Location | Xq28 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; |
Function | ATP binding; NF-kappaB-inducing kinase activity; interleukin-1 receptor binding; kinase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
IRAK1-5726HF | Recombinant Full Length Human IRAK1 Protein, GST-tagged | +Inquiry |
IRAK1-5056H | Recombinant Human IRAK1 Protein, GST-tagged | +Inquiry |
IRAK1-01H | Active Recombinant Human IRAK1 Protein, GST-tagged | +Inquiry |
IRAK1-799H | Recombinant Human IRAK1 Protein, GST/His-tagged | +Inquiry |
IRAK1-2103H | Recombinant Human IRAK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRAK1-5173HCL | Recombinant Human IRAK1 293 Cell Lysate | +Inquiry |
IRAK1-5174HCL | Recombinant Human IRAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRAK1 Products
Required fields are marked with *
My Review for All IRAK1 Products
Required fields are marked with *