Recombinant Human ITGA6 protein, His-tagged
Cat.No. : | ITGA6-3016H |
Product Overview : | Recombinant Human ITGA6 protein(477-690 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 477-690 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | TPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ITGA6 integrin, alpha 6 [ Homo sapiens ] |
Official Symbol | ITGA6 |
Synonyms | ITGA6; integrin, alpha 6; integrin alpha-6; CD49f; integrin alpha6B; CD49 antigen-like family member F; VLA-6; ITGA6B; FLJ18737; DKFZp686J01244; |
Gene ID | 3655 |
mRNA Refseq | NM_000210 |
Protein Refseq | NP_000201 |
MIM | 147556 |
UniProt ID | P23229 |
◆ Recombinant Proteins | ||
ITGA6-609H | Active Recombinant Human ITGA6 | +Inquiry |
ITGA6-2700H | Recombinant Human ITGA6 protein(621-730 aa), C-His-tagged | +Inquiry |
ITGA6-4315H | Recombinant Human ITGA6 Protein (Met1-Arg938), C-His tagged | +Inquiry |
ITGA6-2612H | Recombinant Human ITGA6 Protein, MYC/DDK-tagged | +Inquiry |
ITGA6 & ITGB4-610H | Recombinant Human ITGA6 & ITGB4 protein, Flag/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGA6-5131HCL | Recombinant Human ITGA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGA6 Products
Required fields are marked with *
My Review for All ITGA6 Products
Required fields are marked with *
0
Inquiry Basket