Recombinant Human LAMA5 protein(2381-2460 aa), C-His-tagged

Cat.No. : LAMA5-2461H
Product Overview : Recombinant Human LAMA5 protein(O15230)(2381-2460 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2381-2460 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : LMDLREALNRAVDATREAQELNSRNQERLEEALQRKQELSRDNATLQATLHAARDTLASVFRLLHSLDQAKEELERLAAS
Gene Name LAMA5 laminin, alpha 5 [ Homo sapiens ]
Official Symbol LAMA5
Synonyms LAMA5; laminin, alpha 5; laminin subunit alpha-5; laminin alpha-5 chain; laminin-10 subunit alpha; laminin-11 subunit alpha; laminin-15 subunit alpha; KIAA1907;
Gene ID 3911
mRNA Refseq NM_005560
Protein Refseq NP_005551
MIM 601033
UniProt ID O15230

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LAMA5 Products

Required fields are marked with *

My Review for All LAMA5 Products

Required fields are marked with *

0
cart-icon