Recombinant Human LAMA5 protein(2381-2460 aa), C-His-tagged
| Cat.No. : | LAMA5-2461H |
| Product Overview : | Recombinant Human LAMA5 protein(O15230)(2381-2460 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2381-2460 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | LMDLREALNRAVDATREAQELNSRNQERLEEALQRKQELSRDNATLQATLHAARDTLASVFRLLHSLDQAKEELERLAAS |
| Gene Name | LAMA5 laminin, alpha 5 [ Homo sapiens ] |
| Official Symbol | LAMA5 |
| Synonyms | LAMA5; laminin, alpha 5; laminin subunit alpha-5; laminin alpha-5 chain; laminin-10 subunit alpha; laminin-11 subunit alpha; laminin-15 subunit alpha; KIAA1907; |
| Gene ID | 3911 |
| mRNA Refseq | NM_005560 |
| Protein Refseq | NP_005551 |
| MIM | 601033 |
| UniProt ID | O15230 |
| ◆ Recombinant Proteins | ||
| Lama5-217M | Recombinant Mouse Lama5 Protein, His-tagged | +Inquiry |
| LAMA5-0375H | Active Recombinant Human LAMA5 protein, Fc-tagged | +Inquiry |
| LAMA5-0356H | Active Recombinant Human LAMA5 protein, Fc-tagged | +Inquiry |
| LAMA5-3613Z | Recombinant Zebrafish LAMA5 | +Inquiry |
| LAMA5-2384H | Recombinant Human LAMA5 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LAMA5-968HCL | Recombinant Human LAMA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAMA5 Products
Required fields are marked with *
My Review for All LAMA5 Products
Required fields are marked with *
