Recombinant Human LRP2 protein(4531-4600 aa), C-His-tagged

• Cat.No.: LRP2-2811H
• Product Overview: Recombinant Human LRP2 protein(P98164)(4531-4600 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 4531-4600 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: SAVKVVQPIQVTVSENVDNKNYGSPINPSEIVPETNPTSPAADGTQVTKWNLFKRKSKQTTNFENPIYAQ

Gene Information

• Gene Name: LRP2 low density lipoprotein receptor-related protein 2 [ Homo sapiens ]
• Official Symbol: LRP2
• Synonyms: LRP2; low density lipoprotein receptor-related protein 2; low-density lipoprotein receptor-related protein 2; DBS; gp330; megalin; LRP-2; glycoprotein 330; calcium sensor protein; Heymann nephritis antigen homolog; GP330
• Gene ID: 4036
• mRNA Refseq: NM_004525
• Protein Refseq: NP_004516
• MIM: 600073
• UniProt ID: P98164