Recombinant Human LRP2 protein(4531-4600 aa), C-His-tagged

Cat.No. : LRP2-2811H
Product Overview : Recombinant Human LRP2 protein(P98164)(4531-4600 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 4531-4600 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SAVKVVQPIQVTVSENVDNKNYGSPINPSEIVPETNPTSPAADGTQVTKWNLFKRKSKQTTNFENPIYAQ
Gene Name LRP2 low density lipoprotein receptor-related protein 2 [ Homo sapiens ]
Official Symbol LRP2
Synonyms LRP2; low density lipoprotein receptor-related protein 2; low-density lipoprotein receptor-related protein 2; DBS; gp330; megalin; LRP-2; glycoprotein 330; calcium sensor protein; Heymann nephritis antigen homolog; GP330;
Gene ID 4036
mRNA Refseq NM_004525
Protein Refseq NP_004516
MIM 600073
UniProt ID P98164

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRP2 Products

Required fields are marked with *

My Review for All LRP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon