Recombinant Human LRP2 protein, mFc-tagged
Cat.No. : | LRP2-8754H |
Product Overview : | Recombinant Human LRP2 protein(P98164)(1186-1389aa), fused with C-terminal mFc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | mFc |
Protein Length : | 1186-1389aa |
Tag : | C-mFc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE |
Gene Name | LRP2 low density lipoprotein receptor-related protein 2 [ Homo sapiens ] |
Official Symbol | LRP2 |
Synonyms | LRP2; low density lipoprotein receptor-related protein 2; low-density lipoprotein receptor-related protein 2; DBS; gp330; megalin; LRP-2; glycoprotein 330; calcium sensor protein; Heymann nephritis antigen homolog; GP330; |
Gene ID | 4036 |
mRNA Refseq | NM_004525 |
Protein Refseq | NP_004516 |
MIM | 600073 |
UniProt ID | P98164 |
◆ Recombinant Proteins | ||
LRP2-3109R | Recombinant Rat LRP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRP2-27H | Recombinant Human LRP2 Protein, His-tagged | +Inquiry |
LRP2-2811H | Recombinant Human LRP2 protein(4531-4600 aa), C-His-tagged | +Inquiry |
LRP2-1448H | Recombinant Human LRP2 Protein (1186-1389 aa), His-tagged | +Inquiry |
LRP2-5162M | Recombinant Mouse LRP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRP2 Products
Required fields are marked with *
My Review for All LRP2 Products
Required fields are marked with *