Recombinant Human LTA Full Length protein, His-tagged
| Cat.No. : | LTA-4367H |
| Product Overview : | Recombinant Human LTA protein(35-205aa), fused with N-terminal His tag, was expressed in HEK293. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 35-205aa |
| Tag : | N-His |
| Form : | Liquid in sterile PBS, pH7.4. |
| Molecular Mass : | The protein has a calculated MW of 21 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 95 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml. |
| Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | HHHHHHHHHHLVPRGSRTLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| Gene Name | LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ] |
| Official Symbol | LTA |
| Synonyms | LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1; LT-alpha; TNF-beta; tumor necrosis factor beta; tumor necrosis factor ligand superfamily member 1; |
| Gene ID | 4049 |
| mRNA Refseq | NM_000595 |
| Protein Refseq | NP_000586 |
| MIM | 153440 |
| UniProt ID | P01374 |
| ◆ Recombinant Proteins | ||
| Lta-3187M | Recombinant Mouse Lta protein, His&Myc-tagged | +Inquiry |
| LTA-7253H | Recombinant Human LTA protein, His-Avi-tagged, Biotinylated | +Inquiry |
| LTA-5068H | Recombinant Human Lymphotoxin Alpha (TNF superfamily, member 2), His-tagged | +Inquiry |
| LTA-4465H | Recombinant Human LTA Protein (Leu35-Leu205), His tagged | +Inquiry |
| LTA-4597H | Recombinant Human LTA Protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| LTA-14S | Native S. aureus LTA Protein | +Inquiry |
| LTA-18S | Native S. aureus LTA Protein | +Inquiry |
| LTA-15B | Native Bacillus subtilis LTA Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LTA-9167HCL | Recombinant Human LTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LTA Products
Required fields are marked with *
My Review for All LTA Products
Required fields are marked with *
