Recombinant Human LTA Full Length protein, His-tagged
Cat.No. : | LTA-4367H |
Product Overview : | Recombinant Human LTA protein(35-205aa), fused with N-terminal His tag, was expressed in HEK293. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 35-205aa |
Tag : | N-His |
Form : | Liquid in sterile PBS, pH7.4. |
Molecular Mass : | The protein has a calculated MW of 21 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 95 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml. |
Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | HHHHHHHHHHLVPRGSRTLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
Gene Name | LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ] |
Official Symbol | LTA |
Synonyms | LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1; LT-alpha; TNF-beta; tumor necrosis factor beta; tumor necrosis factor ligand superfamily member 1; |
Gene ID | 4049 |
mRNA Refseq | NM_000595 |
Protein Refseq | NP_000586 |
MIM | 153440 |
UniProt ID | P01374 |
◆ Recombinant Proteins | ||
LTA-5068H | Recombinant Human Lymphotoxin Alpha (TNF superfamily, member 2), His-tagged | +Inquiry |
LTA-4599H | Recombinant Human LTA Protein, His/Flag/StrepII-tagged | +Inquiry |
LTA-145H | Recombinant Human lymphotoxin alpha Protein, Tag Free | +Inquiry |
LTA-31535TH | Recombinant Human LTA | +Inquiry |
LTA-31534TH | Recombinant Human LTA, His-tagged | +Inquiry |
◆ Native Proteins | ||
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
LTA-15B | Native Bacillus subtilis LTA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTA-9167HCL | Recombinant Human LTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTA Products
Required fields are marked with *
My Review for All LTA Products
Required fields are marked with *
0
Inquiry Basket