Recombinant Human LTA Full Length protein, His-tagged

• Cat.No.: LTA-4367H
• Product Overview: Recombinant Human LTA protein(35-205aa), fused with N-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 35-205aa
• Tag: N-His
• Form: Liquid in sterile PBS, pH7.4.
• Molecular Mass: The protein has a calculated MW of 21 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 95 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml.
• Reconstitution: Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: HHHHHHHHHHLVPRGSRTLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Gene Information

• Gene Name: LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ]
• Official Symbol: LTA
• Synonyms: LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1; LT-alpha; TNF-beta; tumor necrosis factor beta; tumor necrosis factor ligand superfamily member 1
• Gene ID: 4049
• mRNA Refseq: NM_000595
• Protein Refseq: NP_000586
• MIM: 153440
• UniProt ID: P01374