Recombinant Human LY6G5B Protein, His tagged

• Cat.No.: LY6G5B-001H
• Product Overview: Recombinant Human LY6G5B Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 19-201 aa
• Description: LY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction.
• Form: Sterile PBS, pH7.4, 0.1% SKL
• Molecular Mass: 22 kDa
• AASequence: MHHHHHHHHHHKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITIYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQAGLLTPHPS
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: LY6G5B lymphocyte antigen 6 complex, locus G5B [ Homo sapiens (human) ]
• Official Symbol: LY6G5B
• Synonyms: LY6G5B; lymphocyte antigen 6 complex, locus G5B; C6orf19, chromosome 6 open reading frame 19; lymphocyte antigen 6 complex locus protein G5b; G5b; lymphocyte antigen-6 G5B; C6orf19
• Gene ID: 58496
• mRNA Refseq: NM_021221
• Protein Refseq: NP_067044
• MIM: 610433
• UniProt ID: Q8NDX9