Recombinant Human MAP2 protein(401-500 aa), C-His-tagged

• Cat.No.: MAP2-2633H
• Product Overview: Recombinant Human MAP2 protein(P11137)(401-500 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 401-500 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: EHVMGKVLEEEKEAINQETVQQRDTFTPSGQEPILTEKETELKLEEKTTISDKEAVPKESKPPKPADEEIGIIQTSTEHTFSEQKDQEPTTDMLKQDSFP

Gene Information

• Gene Name: MAP2 microtubule-associated protein 2 [ Homo sapiens ]
• Official Symbol: MAP2
• Synonyms: MAP2; microtubule-associated protein 2; MAP2A; MAP2B; MAP2C; MAP-2; DKFZp686I2148
• Gene ID: 4133
• mRNA Refseq: NM_001039538
• Protein Refseq: NP_001034627
• MIM: 157130
• UniProt ID: P11137