Recombinant Human MAP2 protein(401-500 aa), C-His-tagged
Cat.No. : | MAP2-2633H |
Product Overview : | Recombinant Human MAP2 protein(P11137)(401-500 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 401-500 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EHVMGKVLEEEKEAINQETVQQRDTFTPSGQEPILTEKETELKLEEKTTISDKEAVPKESKPPKPADEEIGIIQTSTEHTFSEQKDQEPTTDMLKQDSFP |
Gene Name | MAP2 microtubule-associated protein 2 [ Homo sapiens ] |
Official Symbol | MAP2 |
Synonyms | MAP2; microtubule-associated protein 2; MAP2A; MAP2B; MAP2C; MAP-2; DKFZp686I2148; |
Gene ID | 4133 |
mRNA Refseq | NM_001039538 |
Protein Refseq | NP_001034627 |
MIM | 157130 |
UniProt ID | P11137 |
◆ Recombinant Proteins | ||
MAP2-047H | Recombinant Human MAP2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAP2-4493H | Recombinant Human MAP2 Protein (Gly1689-Lys1824), N-His tagged | +Inquiry |
MAP2-284H | Recombinant Human MAP2 | +Inquiry |
Map2-6821M | Recombinant Mouse Map2 protein, His & GST-tagged | +Inquiry |
MAP2-214HFL | Recombinant Full Length Human MAP2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP2-4512HCL | Recombinant Human MAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP2 Products
Required fields are marked with *
My Review for All MAP2 Products
Required fields are marked with *