Recombinant Human MAP2 protein(401-500 aa), C-His-tagged

Cat.No. : MAP2-2633H
Product Overview : Recombinant Human MAP2 protein(P11137)(401-500 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 401-500 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : EHVMGKVLEEEKEAINQETVQQRDTFTPSGQEPILTEKETELKLEEKTTISDKEAVPKESKPPKPADEEIGIIQTSTEHTFSEQKDQEPTTDMLKQDSFP
Gene Name MAP2 microtubule-associated protein 2 [ Homo sapiens ]
Official Symbol MAP2
Synonyms MAP2; microtubule-associated protein 2; MAP2A; MAP2B; MAP2C; MAP-2; DKFZp686I2148;
Gene ID 4133
mRNA Refseq NM_001039538
Protein Refseq NP_001034627
MIM 157130
UniProt ID P11137

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAP2 Products

Required fields are marked with *

My Review for All MAP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon