Recombinant Human MAP3K14 protein, His-tagged
| Cat.No. : | MAP3K14-2677H |
| Product Overview : | Recombinant Human MAP3K14 protein(16-228 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 26, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 16-228 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | VGQQKELPKAKEKTPPLGKKQSSVYKLEAVEKSPVFCGKWEILNDVITKGTAKEGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNNVAHATEGKMARVCWKGKRRSKARKKRKKKSSKSLAHAGVALAKPLPRTPEQESCTIPVQEDESPLGAPYVRNTPQFTKPLKEPGLGQLCFKQLGEGLRPALPRSELHK |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MAP3K14 mitogen-activated protein kinase kinase kinase 14 [ Homo sapiens ] |
| Official Symbol | MAP3K14 |
| Synonyms | MAP3K14; mitogen-activated protein kinase kinase kinase 14; FTDCR1B; HS; HSNIK; NIK; serine/threonine protein kinase; NF-kappa-beta-inducing kinase; serine/threonine protein-kinase; serine/threonine-protein kinase NIK; |
| Gene ID | 9020 |
| mRNA Refseq | NM_003954 |
| Protein Refseq | NP_003945 |
| MIM | 604655 |
| UniProt ID | Q99558 |
| ◆ Recombinant Proteins | ||
| MAP3K14-1065 | Active Recombinant Human MAP3K14 protein, GST-tagged | +Inquiry |
| MAP3K14-556H | Recombinant Human MAP3K14, GST-tagged | +Inquiry |
| MAP3K14-30381TH | Recombinant Human MAP3K14 | +Inquiry |
| MAP3K14-01H | Active Recombinant Human MAP3K14 Protein, GST&His-tagged | +Inquiry |
| MAP3K14-2488R | Recombinant Rhesus Macaque MAP3K14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAP3K14-4507HCL | Recombinant Human MAP3K14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP3K14 Products
Required fields are marked with *
My Review for All MAP3K14 Products
Required fields are marked with *
