Recombinant Human MELK Protein, GST-tagged
Cat.No. : | MELK-4447H |
Product Overview : | Human MELK partial ORF ( AAH14039, 550 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MELK (Maternal Embryonic Leucine Zipper Kinase) is a Protein Coding gene. Among its related pathways are Neuroscience. GO annotations related to this gene include calcium ion binding and protein kinase activity. An important paralog of this gene is SNRK. |
Molecular Mass : | 36.85 kDa |
AA Sequence : | ARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MELK maternal embryonic leucine zipper kinase [ Homo sapiens ] |
Official Symbol | MELK |
Synonyms | MELK; maternal embryonic leucine zipper kinase; KIAA0175; pEg3 kinase; protein kinase Eg3; protein kinase PK38; tyrosine-protein kinase MELK; HPK38; |
Gene ID | 9833 |
mRNA Refseq | NM_001256685 |
Protein Refseq | NP_001243614 |
MIM | 607025 |
UniProt ID | Q14680 |
◆ Recombinant Proteins | ||
MELK-30097TH | Recombinant Human MELK | +Inquiry |
MELK-1135H | Recombinant Human MELK Protein (D3-V330), His tagged | +Inquiry |
MELK-1134H | Recombinant Human MELK Protein (D3-V330), Tag Free | +Inquiry |
MELK-5473M | Recombinant Mouse MELK Protein, His (Fc)-Avi-tagged | +Inquiry |
MELK-9725M | Recombinant Mouse MELK Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MELK-4368HCL | Recombinant Human MELK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MELK Products
Required fields are marked with *
My Review for All MELK Products
Required fields are marked with *
0
Inquiry Basket