Recombinant Human MELK Protein, GST-tagged

Cat.No. : MELK-4447H
Product Overview : Human MELK partial ORF ( AAH14039, 550 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MELK (Maternal Embryonic Leucine Zipper Kinase) is a Protein Coding gene. Among its related pathways are Neuroscience. GO annotations related to this gene include calcium ion binding and protein kinase activity. An important paralog of this gene is SNRK.
Molecular Mass : 36.85 kDa
AA Sequence : ARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MELK maternal embryonic leucine zipper kinase [ Homo sapiens ]
Official Symbol MELK
Synonyms MELK; maternal embryonic leucine zipper kinase; KIAA0175; pEg3 kinase; protein kinase Eg3; protein kinase PK38; tyrosine-protein kinase MELK; HPK38;
Gene ID 9833
mRNA Refseq NM_001256685
Protein Refseq NP_001243614
MIM 607025
UniProt ID Q14680

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MELK Products

Required fields are marked with *

My Review for All MELK Products

Required fields are marked with *

0
cart-icon
0
compare icon