Recombinant Human MERTK Protein, GST-tagged
| Cat.No. : | MERTK-4436H |
| Product Overview : | Human MERTK partial ORF ( NP_006334, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP). [provided by RefSeq |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | AITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSINVP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MERTK c-mer proto-oncogene tyrosine kinase [ Homo sapiens ] |
| Official Symbol | MERTK |
| Synonyms | MERTK; c-mer proto-oncogene tyrosine kinase; tyrosine-protein kinase Mer; mer; RP38; STK kinase; proto-oncogene c-Mer; MER receptor tyrosine kinase; receptor tyrosine kinase MerTK; MER; c-mer; MGC133349; |
| Gene ID | 10461 |
| mRNA Refseq | NM_006343 |
| Protein Refseq | NP_006334 |
| MIM | 604705 |
| UniProt ID | Q12866 |
| ◆ Recombinant Proteins | ||
| Mertk-5041R | Recombinant Rat Mertk protein, His-tagged | +Inquiry |
| MERTK-4436H | Recombinant Human MERTK Protein, GST-tagged | +Inquiry |
| MERTK-566H | Recombinant Human MERTK Protein, DDK-tagged | +Inquiry |
| MERTK-565H | Recombinant Human MERTK Protein, DDK/His-tagged | +Inquiry |
| MERTK-3650R | Recombinant Rat MERTK Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MERTK-001HCL | Recombinant Human MERTK cell lysate | +Inquiry |
| MERTK-2888HCL | Recombinant Human MERTK cell lysate | +Inquiry |
| MERTK-413MCL | Recombinant Mouse MERTK cell lysate | +Inquiry |
| MERTK-1816MCL | Recombinant Mouse MERTK cell lysate | +Inquiry |
| MERTK-484HCL | Recombinant Human MERTK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MERTK Products
Required fields are marked with *
My Review for All MERTK Products
Required fields are marked with *
