Recombinant Human MERTK Protein, GST-tagged
Cat.No. : | MERTK-4436H |
Product Overview : | Human MERTK partial ORF ( NP_006334, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP). [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | AITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSINVP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MERTK c-mer proto-oncogene tyrosine kinase [ Homo sapiens ] |
Official Symbol | MERTK |
Synonyms | MERTK; c-mer proto-oncogene tyrosine kinase; tyrosine-protein kinase Mer; mer; RP38; STK kinase; proto-oncogene c-Mer; MER receptor tyrosine kinase; receptor tyrosine kinase MerTK; MER; c-mer; MGC133349; |
Gene ID | 10461 |
mRNA Refseq | NM_006343 |
Protein Refseq | NP_006334 |
MIM | 604705 |
UniProt ID | Q12866 |
◆ Recombinant Proteins | ||
MERTK-30094TH | Recombinant Human MERTK | +Inquiry |
Mertk-7397M | Active Recombinant Mouse Mertk protein(Glu573-Tyr867), His&GST-tagged | +Inquiry |
MERTK-1397H | Recombinant Human MERTK Protein, His (Fc)-Avi-tagged | +Inquiry |
Mertk-4035M | Recombinant Mouse Mertk Protein, Myc/DDK-tagged | +Inquiry |
Mertk-5041R | Recombinant Rat Mertk protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MERTK-2888HCL | Recombinant Human MERTK cell lysate | +Inquiry |
MERTK-413MCL | Recombinant Mouse MERTK cell lysate | +Inquiry |
MERTK-001HCL | Recombinant Human MERTK cell lysate | +Inquiry |
MERTK-484HCL | Recombinant Human MERTK cell lysate | +Inquiry |
MERTK-1816MCL | Recombinant Mouse MERTK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MERTK Products
Required fields are marked with *
My Review for All MERTK Products
Required fields are marked with *
0
Inquiry Basket