Recombinant Human MGAT5 Protein, GST-tagged

Cat.No. : MGAT5-4363H
Product Overview : Human MGAT5 partial ORF ( NP_002401, 642 a.a. - 739 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, a glycosyltransferase involved in the synthesis of protein-bound and lipid-bound oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the encoded proteins activity may correlate with the progression of invasive malignancies. [provided by RefSeq
Molecular Mass : 36.52 kDa
AA Sequence : LAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MGAT5 mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase [ Homo sapiens ]
Official Symbol MGAT5
Synonyms MGAT5; mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase; alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A; GNT V; glcNAc-T V; N-acetylglucosaminyl-transferase V; mannoside acetylglucosaminyltransferase 5; alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase; GNT-V; GNT-VA; FLJ31899; FLJ43217; DKFZp686B24166;
Gene ID 4249
mRNA Refseq NM_002410
Protein Refseq NP_002401
MIM 601774
UniProt ID Q09328

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MGAT5 Products

Required fields are marked with *

My Review for All MGAT5 Products

Required fields are marked with *

0
cart-icon
0
compare icon