Recombinant Human MGAT5 Protein, GST-tagged
Cat.No. : | MGAT5-4363H |
Product Overview : | Human MGAT5 partial ORF ( NP_002401, 642 a.a. - 739 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, a glycosyltransferase involved in the synthesis of protein-bound and lipid-bound oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the encoded proteins activity may correlate with the progression of invasive malignancies. [provided by RefSeq |
Molecular Mass : | 36.52 kDa |
AA Sequence : | LAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MGAT5 mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase [ Homo sapiens ] |
Official Symbol | MGAT5 |
Synonyms | MGAT5; mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase; alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A; GNT V; glcNAc-T V; N-acetylglucosaminyl-transferase V; mannoside acetylglucosaminyltransferase 5; alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase; GNT-V; GNT-VA; FLJ31899; FLJ43217; DKFZp686B24166; |
Gene ID | 4249 |
mRNA Refseq | NM_002410 |
Protein Refseq | NP_002401 |
MIM | 601774 |
UniProt ID | Q09328 |
◆ Recombinant Proteins | ||
RFL25525RF | Recombinant Full Length Rat Alpha-1,6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase A(Mgat5) Protein, Tag-Free | +Inquiry |
MGAT5-4300Z | Recombinant Zebrafish MGAT5 | +Inquiry |
MGAT5-1120H | Active Recombinant Human MGAT5 protein, His-tagged | +Inquiry |
MGAT5-04H | Recombinant Human MGAT5 Protein (AA 31-741), N-6×His/GFP tagged | +Inquiry |
MGAT5-4363H | Recombinant Human MGAT5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGAT5-2067HCL | Recombinant Human MGAT5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGAT5 Products
Required fields are marked with *
My Review for All MGAT5 Products
Required fields are marked with *