Recombinant Human MOG Protein, His/Avi-tagged, Biotinylated
Cat.No. : | MOG-02H |
Product Overview : | Recombinant biotinylated human MOG protein with His/Avi-tag was expressed in HEK293 |
Availability | August 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Avi&His |
Description : | The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Mass : | The protein has a calculated MW of 17 kDa. |
AA Sequence : | GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVDHHHHHHGLNDIFEAQKIEWHE |
Endotoxin : | <1 EU/μg |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Lyophilized from sterile PBS, pH7.4, 5% trehalose, 5% mannitol |
Conjugation : | Biotin |
Gene Name | MOG myelin oligodendrocyte glycoprotein [ Homo sapiens (human) ] |
Official Symbol | MOG |
Synonyms | MOG; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5; MOGIG2; NRCLP7; MGC26137; |
Gene ID | 4340 |
mRNA Refseq | NM_001008228 |
Protein Refseq | NP_001008229 |
MIM | 159465 |
UniProt ID | Q16653 |
◆ Recombinant Proteins | ||
MOG-061H | Recombinant Human MOG Protein, HIS-tagged | +Inquiry |
MOG-02H | Recombinant Human MOG Protein, His/Avi-tagged, Biotinylated | +Inquiry |
MOG-4584H | Recombinant Human MOG Protein (Gly30-Gly154), C-His tagged | +Inquiry |
MOG-301349H | Recombinant Human MOG protein, GST-tagged | +Inquiry |
Mog-6755M | Recombinant Mouse Mog Protein (Gln29-Gly125), N-His tagged | +Inquiry |
◆ Native Proteins | ||
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOG-1126HCL | Recombinant Human MOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOG Products
Required fields are marked with *
My Review for All MOG Products
Required fields are marked with *