Recombinant Human MOG Protein, His/Avi-tagged, Biotinylated

• Cat.No.: MOG-02H
• Product Overview: Recombinant biotinylated human MOG protein with His/Avi-tag was expressed in HEK293

Specification

• Species: Human
• Source: HEK293
• Tag: Avi&His
• Description: The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Molecular Mass: The protein has a calculated MW of 17 kDa.
• AA Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVDHHHHHHGLNDIFEAQKIEWHE
• Endotoxin: <1 EU/μg
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from sterile PBS, pH7.4, 5% trehalose, 5% mannitol
• Conjugation: Biotin

Gene Information

• Gene Name: MOG myelin oligodendrocyte glycoprotein [ Homo sapiens (human) ]
• Official Symbol: MOG
• Synonyms: MOG; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5; MOGIG2; NRCLP7; MGC26137
• Gene ID: 4340
• mRNA Refseq: NM_001008228
• Protein Refseq: NP_001008229
• MIM: 159465
• UniProt ID: Q16653