Recombinant Human MOG Protein, His/Avi-tagged, Biotinylated

Cat.No. : MOG-02H
Product Overview : Recombinant biotinylated human MOG protein with His/Avi-tag was expressed in HEK293
Availability August 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Avi&His
Description : The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Mass : The protein has a calculated MW of 17 kDa.
AA Sequence : GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVDHHHHHHGLNDIFEAQKIEWHE
Endotoxin : <1 EU/μg
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Lyophilized from sterile PBS, pH7.4, 5% trehalose, 5% mannitol
Conjugation : Biotin
Gene Name MOG myelin oligodendrocyte glycoprotein [ Homo sapiens (human) ]
Official Symbol MOG
Synonyms MOG; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5; MOGIG2; NRCLP7; MGC26137;
Gene ID 4340
mRNA Refseq NM_001008228
Protein Refseq NP_001008229
MIM 159465
UniProt ID Q16653

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOG Products

Required fields are marked with *

My Review for All MOG Products

Required fields are marked with *

0
cart-icon