Recombinant Human MOG Protein, HIS-tagged
Cat.No. : | MOG-061H |
Product Overview : | Recombinant Human MOG fused with His tag at C-termina was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
Molecular Mass : | 15.31kD |
AA Sequence : | GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | MOG myelin oligodendrocyte glycoprotein [ Homo sapiens ] |
Official Symbol | MOG |
Synonyms | MOG; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5; MOGIG2; NRCLP7; MGC26137; |
Gene ID | 4340 |
mRNA Refseq | NM_001008228 |
Protein Refseq | NP_001008229 |
MIM | 159465 |
UniProt ID | Q16653 |
◆ Recombinant Proteins | ||
Mog-2445M | Recombinant Mouse Mog protein, hFc-tagged | +Inquiry |
Mog-6366M | Recombinant Mouse Mog protein, His-tagged | +Inquiry |
MOG-041H | Recombinant Human myelin oligodendrocyte glycoprotein Protein, His tagged | +Inquiry |
Mog-3101M | Recombinant Mouse Mog protein, His-tagged | +Inquiry |
MOG-640H | Recombinant Human MOG, Fc-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOG-1126HCL | Recombinant Human MOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOG Products
Required fields are marked with *
My Review for All MOG Products
Required fields are marked with *