Recombinant Human MS4A15 Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MS4A15-161H |
| Product Overview : | MS4A15 MS Standard C13 and N15-labeled recombinant protein (NP_689930) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | May be involved in signal transduction as a component of a multimeric receptor complex. |
| Molecular Mass : | 15.4 kDa |
| AA Sequence : | MVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNVAYAQGVVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MS4A15 membrane spanning 4-domains A15 [ Homo sapiens (human) ] |
| Official Symbol | MS4A15 |
| Synonyms | MS4A15; membrane spanning 4-domains A15; FLJ34527; MGC35295; membrane-spanning 4-domains subfamily A member 15 |
| Gene ID | 219995 |
| mRNA Refseq | NM_152717 |
| Protein Refseq | NP_689930 |
| UniProt ID | Q8N5U1 |
| ◆ Recombinant Proteins | ||
| MS4A15-5734M | Recombinant Mouse MS4A15 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL27949MF | Recombinant Full Length Mouse Membrane-Spanning 4-Domains Subfamily A Member 15(Ms4A15) Protein, His-Tagged | +Inquiry |
| MS4A15-161H | Recombinant Human MS4A15 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Ms4a15-4179M | Recombinant Mouse Ms4a15 Protein, Myc/DDK-tagged | +Inquiry |
| MS4A15-6403HF | Recombinant Full Length Human MS4A15 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MS4A15-4127HCL | Recombinant Human MS4A15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A15 Products
Required fields are marked with *
My Review for All MS4A15 Products
Required fields are marked with *




