Recombinant Human MTNR1A protein, GST-tagged
| Cat.No. : | MTNR1A-301234H |
| Product Overview : | Recombinant Human MTNR1A (1-42 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Ile42 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MQGNGSALPNASQPVLRGDGARPSWLASALACVLIFTIVVDI |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MTNR1A melatonin receptor 1A [ Homo sapiens ] |
| Official Symbol | MTNR1A |
| Synonyms | MTNR1A; melatonin receptor 1A; melatonin receptor type 1A; MEL 1A R; mel1a receptor; MT1; MEL-1A-R; |
| Gene ID | 4543 |
| mRNA Refseq | NM_005958 |
| Protein Refseq | NP_005949 |
| MIM | 600665 |
| UniProt ID | P48039 |
| ◆ Recombinant Proteins | ||
| MTNR1A-301234H | Recombinant Human MTNR1A protein, GST-tagged | +Inquiry |
| RFL23708RF | Recombinant Full Length Rat Melatonin Receptor Type 1A(Mtnr1A) Protein, His-Tagged | +Inquiry |
| MTNR1A-8163G | Recombinant Goat MTNR1A protein, His & S-tagged | +Inquiry |
| MTNR1A-556H | Recombinant Human MTNR1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MTNR1A-1482HFL | Recombinant Full Length Human MTNR1A Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTNR1A-4071HCL | Recombinant Human MTNR1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTNR1A Products
Required fields are marked with *
My Review for All MTNR1A Products
Required fields are marked with *
