Recombinant Human MTNR1A protein, GST-tagged
Cat.No. : | MTNR1A-301234H |
Product Overview : | Recombinant Human MTNR1A (1-42 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Met1-Ile42 |
AA Sequence : | MQGNGSALPNASQPVLRGDGARPSWLASALACVLIFTIVVDI |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name : | MTNR1A melatonin receptor 1A [ Homo sapiens ] |
Official Symbol : | MTNR1A |
Synonyms : | MTNR1A; melatonin receptor 1A; melatonin receptor type 1A; MEL 1A R; mel1a receptor; MT1; MEL-1A-R; |
Gene ID : | 4543 |
mRNA Refseq : | NM_005958 |
Protein Refseq : | NP_005949 |
MIM : | 600665 |
UniProt ID : | P48039 |
Products Types
◆ Recombinant Protein | ||
MTNR1A-5726H | Recombinant Human MTNR1A Protein, GST-tagged | +Inquiry |
Mtnr1a-4221M | Recombinant Mouse Mtnr1a Protein, Myc/DDK-tagged | +Inquiry |
MTNR1A-1142C | Recombinant Chicken MTNR1A Protein, His-tagged | +Inquiry |
MTNR1A-1455H | Recombinant Human MTNR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
MTNR1A-8162C | Recombinant Cattle MTNR1A protein, His & S-tagged | +Inquiry |
◆ Lysates | ||
MTNR1A-4071HCL | Recombinant Human MTNR1A 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1431 | cAMP MTNR1A CHO-K1 GPCR Assay Kit | +Inquiry |
Kit-1430 | MTNR1A CHO-K1 β-Arrestin GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket