Recombinant Human MTNR1A protein, GST-tagged

Cat.No. : MTNR1A-301234H
Product Overview : Recombinant Human MTNR1A (1-42 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Ile42
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MQGNGSALPNASQPVLRGDGARPSWLASALACVLIFTIVVDI
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MTNR1A melatonin receptor 1A [ Homo sapiens ]
Official Symbol MTNR1A
Synonyms MTNR1A; melatonin receptor 1A; melatonin receptor type 1A; MEL 1A R; mel1a receptor; MT1; MEL-1A-R;
Gene ID 4543
mRNA Refseq NM_005958
Protein Refseq NP_005949
MIM 600665
UniProt ID P48039

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTNR1A Products

Required fields are marked with *

My Review for All MTNR1A Products

Required fields are marked with *

0
cart-icon