Recombinant Human MUC2 protein, His-tagged

Cat.No. : MUC2-3254H
Product Overview : Recombinant Human MUC2 protein(Q02817)(36-240aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 36-240aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 28.8 kDa
AA Sequence : VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name MUC2 mucin 2, oligomeric mucus/gel-forming [ Homo sapiens ]
Official Symbol MUC2
Synonyms MUC2; mucin 2, oligomeric mucus/gel-forming; mucin 2, intestinal/tracheal; mucin-2; intestinal mucin-2; mucin-like protein; MLP; SMUC; MUC-2;
Gene ID 4583
mRNA Refseq NM_002457
Protein Refseq NP_002448
MIM 158370
UniProt ID Q02817

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUC2 Products

Required fields are marked with *

My Review for All MUC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon