Recombinant Human MUC2 protein, His-tagged
Cat.No. : | MUC2-3254H |
Product Overview : | Recombinant Human MUC2 protein(Q02817)(36-240aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 36-240aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.8 kDa |
AA Sequence : | VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MUC2 mucin 2, oligomeric mucus/gel-forming [ Homo sapiens ] |
Official Symbol | MUC2 |
Synonyms | MUC2; mucin 2, oligomeric mucus/gel-forming; mucin 2, intestinal/tracheal; mucin-2; intestinal mucin-2; mucin-like protein; MLP; SMUC; MUC-2; |
Gene ID | 4583 |
mRNA Refseq | NM_002457 |
Protein Refseq | NP_002448 |
MIM | 158370 |
UniProt ID | Q02817 |
◆ Recombinant Proteins | ||
Muc2-690M | Recombinant Mouse Muc2 protein, His-tagged | +Inquiry |
MUC2-3254H | Recombinant Human MUC2 protein, His-tagged | +Inquiry |
Muc2-689M | Recombinant Mouse Muc2 protein, His-tagged | +Inquiry |
MUC2-1466H | Recombinant Human MUC2 Protein (36-240 aa), His-tagged | +Inquiry |
Muc2-691M | Recombinant Mouse Muc2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MUC2-28P | Native Pig Mucin 2 (MUC2) Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC2 Products
Required fields are marked with *
My Review for All MUC2 Products
Required fields are marked with *