Recombinant Human MYL12A protein, His-SUMO-tagged
Cat.No. : | MYL12A-5323H |
Product Overview : | Recombinant Human MYL12A protein(P19105)(1-171aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-171aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD |
Gene Name | MYL12A myosin, light chain 12A, regulatory, non-sarcomeric [ Homo sapiens ] |
Official Symbol | MYL12A |
Synonyms | MYL12A; myosin, light chain 12A, regulatory, non-sarcomeric; myosin, light polypeptide, regulatory, non sarcomeric (20kD); myosin regulatory light chain 12A; MLCB; MRCL3; MRLC3; MYL2B; myosin regulatory light chain 3; MLC-2B; myosin RLC; myosin regulatory light chain MRCL3; myosin regulatory light chain MRLC3; myosin regulatory light chain 2, nonsarcomeric; myosin, light polypeptide, regulatory, non-sarcomeric (20kD); |
Gene ID | 10627 |
mRNA Refseq | NM_006471 |
Protein Refseq | NP_006462 |
UniProt ID | P19105 |
◆ Recombinant Proteins | ||
MYL12A-4844H | Recombinant Human MYL12A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MYL12A-5536H | Recombinant Human MYL12A Protein, His-tagged | +Inquiry |
MYL12A-3511R | Recombinant Rat MYL12A Protein, His (Fc)-Avi-tagged | +Inquiry |
MYL12A-28634TH | Recombinant Human MYL12A, His-tagged | +Inquiry |
MYL12A-1814H | Recombinant Human MYL12A protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL12A-4030HCL | Recombinant Human MYL12A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL12A Products
Required fields are marked with *
My Review for All MYL12A Products
Required fields are marked with *