Recombinant Human MYL12A protein, His-SUMO-tagged

Cat.No. : MYL12A-5323H
Product Overview : Recombinant Human MYL12A protein(P19105)(1-171aa), fused with N-terminal His and SUMO tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-171aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 32.7 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Gene Name MYL12A myosin, light chain 12A, regulatory, non-sarcomeric [ Homo sapiens ]
Official Symbol MYL12A
Synonyms MYL12A; myosin, light chain 12A, regulatory, non-sarcomeric; myosin, light polypeptide, regulatory, non sarcomeric (20kD); myosin regulatory light chain 12A; MLCB; MRCL3; MRLC3; MYL2B; myosin regulatory light chain 3; MLC-2B; myosin RLC; myosin regulatory light chain MRCL3; myosin regulatory light chain MRLC3; myosin regulatory light chain 2, nonsarcomeric; myosin, light polypeptide, regulatory, non-sarcomeric (20kD);
Gene ID 10627
mRNA Refseq NM_006471
Protein Refseq NP_006462
UniProt ID P19105

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL12A Products

Required fields are marked with *

My Review for All MYL12A Products

Required fields are marked with *

0
cart-icon
0
compare icon