Recombinant Human MYL12A Protein, His-tagged

• Cat.No.: MYL12A-5536H
• Product Overview: Human MRCL3 (NP_006462, 1 a.a. - 171 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.[provided by RefSeq, Dec 2014]
• Form: Liquid
• Molecular Mass: 22.4 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL
• Storage Buffer: In 20 mM Tris-HCl, pH 8.0 (20% glycerol, 1 mM dithiothreitol)

Gene Information

• Gene Name: MYL12A myosin light chain 12A [ Homo sapiens (human) ]
• Official Symbol: MYL12A
• Synonyms: MYL12A; myosin light chain 12A; MLCB; MRCL3; MRLC3; MYL2B; MLC-2B; HEL-S-24; myosin regulatory light chain 12A; epididymis secretory protein Li 24; myosin RLC; myosin regulatory light chain 2, nonsarcomeric; myosin regulatory light chain 3; myosin regulatory light chain MRLC3; myosin, light chain 12A, regulatory, non-sarcomeric; myosin, light polypeptide, regulatory, non-sarcomeric (20kD)
• Gene ID: 10627
• mRNA Refseq: NM_001303047
• Protein Refseq: NP_001289976
• UniProt ID: P19105