Recombinant Human MYL12A Protein, His-tagged
| Cat.No. : | MYL12A-5536H |
| Product Overview : | Human MRCL3 (NP_006462, 1 a.a. - 171 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.[provided by RefSeq, Dec 2014] |
| Form : | Liquid |
| Molecular Mass : | 22.4 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSHMSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD |
| Purity : | > 90% by SDS-PAGE |
| Applications : | SDS-PAGE |
| Storage : | Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Concentration : | 0.25 mg/mL |
| Storage Buffer : | In 20 mM Tris-HCl, pH 8.0 (20% glycerol, 1 mM dithiothreitol) |
| Gene Name | MYL12A myosin light chain 12A [ Homo sapiens (human) ] |
| Official Symbol | MYL12A |
| Synonyms | MYL12A; myosin light chain 12A; MLCB; MRCL3; MRLC3; MYL2B; MLC-2B; HEL-S-24; myosin regulatory light chain 12A; epididymis secretory protein Li 24; myosin RLC; myosin regulatory light chain 2, nonsarcomeric; myosin regulatory light chain 3; myosin regulatory light chain MRLC3; myosin, light chain 12A, regulatory, non-sarcomeric; myosin, light polypeptide, regulatory, non-sarcomeric (20kD) |
| Gene ID | 10627 |
| mRNA Refseq | NM_001303047 |
| Protein Refseq | NP_001289976 |
| UniProt ID | P19105 |
| ◆ Recombinant Proteins | ||
| MYL12A-3511R | Recombinant Rat MYL12A Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYL12A-5536H | Recombinant Human MYL12A Protein, His-tagged | +Inquiry |
| MYL12A-5458H | Recombinant Human Myosin, Light Chain 12A, Regulatory, Non-Sarcomeric | +Inquiry |
| MYL12A-843H | Recombinant Human MYL12A protein, His-tagged | +Inquiry |
| MYL12A-3606H | Recombinant Human MYL12A, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYL12A-4030HCL | Recombinant Human MYL12A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL12A Products
Required fields are marked with *
My Review for All MYL12A Products
Required fields are marked with *
