Recombinant Human MYL12A Protein, His-tagged

Cat.No. : MYL12A-5536H
Product Overview : Human MRCL3 (NP_006462, 1 a.a. - 171 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.[provided by RefSeq, Dec 2014]
Form : Liquid
Molecular Mass : 22.4 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSHMSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 0.25 mg/mL
Storage Buffer : In 20 mM Tris-HCl, pH 8.0 (20% glycerol, 1 mM dithiothreitol)
Gene Name MYL12A myosin light chain 12A [ Homo sapiens (human) ]
Official Symbol MYL12A
Synonyms MYL12A; myosin light chain 12A; MLCB; MRCL3; MRLC3; MYL2B; MLC-2B; HEL-S-24; myosin regulatory light chain 12A; epididymis secretory protein Li 24; myosin RLC; myosin regulatory light chain 2, nonsarcomeric; myosin regulatory light chain 3; myosin regulatory light chain MRLC3; myosin, light chain 12A, regulatory, non-sarcomeric; myosin, light polypeptide, regulatory, non-sarcomeric (20kD)
Gene ID 10627
mRNA Refseq NM_001303047
Protein Refseq NP_001289976
UniProt ID P19105

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL12A Products

Required fields are marked with *

My Review for All MYL12A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon