Recombinant Human MYL5 Protein, GST-tagged

Cat.No. : MYL5-5812H
Product Overview : Human MYL5 full-length ORF ( AAH40050.1, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq
Molecular Mass : 40.26 kDa
AA Sequence : MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYL5 myosin, light chain 5, regulatory [ Homo sapiens ]
Official Symbol MYL5
Synonyms MYL5; myosin, light chain 5, regulatory; myosin, light polypeptide 5, regulatory; myosin light chain 5; MYLC2; myLC-2; myosin regulatory light chain 5; superfast myosin regulatory light chain 2;
Gene ID 4636
mRNA Refseq NM_002477
Protein Refseq NP_002468
MIM 160782
UniProt ID Q02045

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL5 Products

Required fields are marked with *

My Review for All MYL5 Products

Required fields are marked with *

0
cart-icon
0
compare icon