Recombinant Human MYL5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MYL5-2489H
Product Overview : MYL5 MS Standard C13 and N15-labeled recombinant protein (NP_002468) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia.
Molecular Mass : 19.4 kDa
AA Sequence : MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MYL5 myosin light chain 5 [ Homo sapiens (human) ]
Official Symbol MYL5
Synonyms MYL5; myosin, light chain 5, regulatory; myosin, light polypeptide 5, regulatory; myosin light chain 5; MYLC2; myLC-2; myosin regulatory light chain 5; superfast myosin regulatory light chain 2;
Gene ID 4636
mRNA Refseq NM_002477
Protein Refseq NP_002468
MIM 160782
UniProt ID Q02045

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL5 Products

Required fields are marked with *

My Review for All MYL5 Products

Required fields are marked with *

0
cart-icon