Recombinant Human MYL6

Cat.No. : MYL6-30267TH
Product Overview : Recombinant full length Human MYL6 expressed in Saccharomyces cerevisiae; amino acids 1-151, 151 amino acids, MWt 16.9kDa. Protein is tagged with 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Protein Length : 1-151 a.a.
Description : Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALG QNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVA KNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTL GEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
Sequence Similarities : Contains 3 EF-hand domains.
Full Length : Full L.
Gene Name MYL6 myosin, light chain 6, alkali, smooth muscle and non-muscle [ Homo sapiens ]
Official Symbol MYL6
Synonyms MYL6; myosin, light chain 6, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6, alkali, smooth muscle and non muscle; myosin light polypeptide 6; ESMLC; MLC1SM; MLC3NM;
Gene ID 4637
mRNA Refseq NM_021019
Protein Refseq NP_066299
MIM 609931
Uniprot ID P60660
Chromosome Location 12q13.13
Pathway Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Muscle contraction, organism-specific biosystem; Sema4D in semaphorin signaling, organism-specific biosystem;
Function actin-dependent ATPase activity; calcium ion binding; motor activity; protein binding; structural constituent of muscle;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MYL6 Products

Required fields are marked with *

My Review for All MYL6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon