Recombinant Human MYL6 Protein, GST-tagged
Cat.No. : | MYL6-5814H |
Product Overview : | Human MYL6 full-length ORF ( NP_066299.2, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq |
Molecular Mass : | 43.3 kDa |
AA Sequence : | MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYL6 myosin, light chain 6, alkali, smooth muscle and non-muscle [ Homo sapiens ] |
Official Symbol | MYL6 |
Synonyms | MYL6; myosin, light chain 6, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6, alkali, smooth muscle and non muscle; myosin light polypeptide 6; ESMLC; MLC1SM; MLC3NM; myosin light chain A3; 17 kDa myosin light chain; myosin light chain alkali 3; myosin, light polypeptide 6, alkali, smooth muscle and non-muscle; LC17; LC17A; LC17B; MLC-3; MLC3SM; LC17-GI; LC17-NM; |
Gene ID | 4637 |
mRNA Refseq | NM_021019 |
Protein Refseq | NP_066299 |
MIM | 609931 |
UniProt ID | P60660 |
◆ Recombinant Proteins | ||
MYL6-30266TH | Recombinant Human MYL6, His-tagged | +Inquiry |
MYL6-6763HF | Recombinant Full Length Human MYL6 Protein, GST-tagged | +Inquiry |
MYL6-10317M | Recombinant Mouse MYL6 Protein | +Inquiry |
MYL6-5814H | Recombinant Human MYL6 Protein, GST-tagged | +Inquiry |
Myl6-4253M | Recombinant Mouse Myl6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL6-4023HCL | Recombinant Human MYL6 293 Cell Lysate | +Inquiry |
MYL6-4024HCL | Recombinant Human MYL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL6 Products
Required fields are marked with *
My Review for All MYL6 Products
Required fields are marked with *