Recombinant Human NANOG Protein, 13-residue TAT-tagged

Cat.No. : NANOG-159H
Product Overview : Recombinant Human NANOG fused with 13-residue TAT tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : TAT
Description : The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Two transcript variants encoding different isoforms have been found for this gene.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
Molecular Mass : 36.2 kDa
AA Sequence : MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVGGYGRKKRRQRRR
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Resuspend the protein in the desired concentration in proper buffer
Gene Name NANOG Nanog homeobox [ Homo sapiens ]
Official Symbol NANOG
Synonyms NANOG; Nanog homeobox; homeobox protein NANOG; FLJ12581; FLJ40451; hNanog; homeobox transcription factor Nanog; homeobox transcription factor Nanog-delta 48;
Gene ID 79923
mRNA Refseq NM_024865
Protein Refseq NP_079141
MIM 607937
UniProt ID Q9H9S0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NANOG Products

Required fields are marked with *

My Review for All NANOG Products

Required fields are marked with *

0
cart-icon