Recombinant Human NANOG Protein, 13-residue TAT-tagged
Cat.No. : | NANOG-159H |
Product Overview : | Recombinant Human NANOG fused with 13-residue TAT tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | TAT |
Description : | The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Molecular Mass : | 36.2 kDa |
AA Sequence : | MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVGGYGRKKRRQRRR |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | NANOG Nanog homeobox [ Homo sapiens ] |
Official Symbol | NANOG |
Synonyms | NANOG; Nanog homeobox; homeobox protein NANOG; FLJ12581; FLJ40451; hNanog; homeobox transcription factor Nanog; homeobox transcription factor Nanog-delta 48; |
Gene ID | 79923 |
mRNA Refseq | NM_024865 |
Protein Refseq | NP_079141 |
MIM | 607937 |
UniProt ID | Q9H9S0 |
◆ Recombinant Proteins | ||
NANOG-3603H | Recombinant Human NANOG, His-tagged | +Inquiry |
NANOG-130H | Active Recombinant Human NANOG protein, Arginine-tagged | +Inquiry |
NANOG-5824H | Recombinant Human NANOG protein, His-tagged | +Inquiry |
NANOG-4924H | Recombinant Human NANOG protein, His&Myc-tagged | +Inquiry |
NANOG-28442TH | Recombinant Human NANOG | +Inquiry |
◆ Cell & Tissue Lysates | ||
NANOG-3981HCL | Recombinant Human NANOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NANOG Products
Required fields are marked with *
My Review for All NANOG Products
Required fields are marked with *