"LCN2" Related Products

Expand
Expand

Recombinant Human NGAL Protein

Cat.No.: LCN2-1026H
Product Overview: Recombinant Human neutrophil gelatinase-associated lipocalin (NGAL) protein with a C-terminal histidine tag. Predicted molecular weight: 22 kDa.
Description: Neutrophil gelatinase-associated lipocalin (NGAL) is a small glycoprotein expressed in the bone marrow, epithelial tissues associated with antimicrobial defense, and in the distal tubules and collecting duct of the kidney. Elevated levels of blood and urine NGAL are associated with acute or chronic renal failure
Source: E. coli
Species: Human
Tag : His
Form: Lyophilized from 0.2 μm filtered solution
Bio-activity: Anti-h NGAL 4202: + Anti-h NGAL 4203: + Anti-h NGAL 4204: + Anti-h NGAL 4205: +
Molecular Mass: 22 kDa
AA Sequence: QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNV TSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYF KITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGSGGHHHHHHHH
Storage: 2–8centigrade
Concentration: 0.5 mg/ml when reconstituted with 200 µl of deionized water
Storage Buffer: Phosphate buffered saline, pH 7.4; containing 3 % sucrose, 2 % D-mannitol and 0.01 % Tween 20 as stabilizers
Reconstitution: Reconstitute lyophilized protein with 200 µl of deionized water
Gene Name: LCN2 lipocalin 2 [ Homo sapiens ]
Official Symbol: LCN2
Synonyms: LCN2; lipocalin 2; lipocalin 2 (oncogene 24p3); neutrophil gelatinase-associated lipocalin; 24p3; neutrophil gelatinase associated lipocalin; NGAL; oncogene 24p3; siderocalin; p25; lipocalin-2; migration-stimulating factor inhibitor; 25 kDa alpha-2-microglobulin-related subunit of MMP-9; MSFI;
Gene ID: 3934
mRNA Refseq: NM_005564
Protein Refseq: NP_005555
MIM: 600181
UniProt ID: P80188

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.