Recombinant Human NLRP3 protein, His-tagged

Cat.No. : NLRP3-3835H
Product Overview : Recombinant Human NLRP3 protein(937-1036 aa), fused to His tag, was expressed in E. coli.
Availability October 31, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 937-1036 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name NLRP3 NLR family, pyrin domain containing 3 [ Homo sapiens ]
Official Symbol NLRP3
Synonyms NLRP3; NLR family, pyrin domain containing 3; C1orf7, CIAS1, cold autoinflammatory syndrome 1; NACHT, LRR and PYD domains-containing protein 3; AGTAVPRL; AII; AVP; CLR1.1; Cryopyrin; FCAS; FCU; MWS; NALP3; nucleotide binding oligomerization domain; leucine rich repeat and pyrin domain containing 3; PYPAF1; cryopyrin; caterpiller protein 1.1; PYRIN-containing APAF1-like protein 1; NACHT, LRR and PYD containing protein 3; cold autoinflammatory syndrome 1 protein; NACHT domain-, leucine-rich repeat-, and PYD-containing protein 3; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 3; CIAS1; C1orf7; FLJ95925;
Gene ID 114548
mRNA Refseq NM_001079821
Protein Refseq NP_001073289
MIM 606416
UniProt ID Q96P20

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NLRP3 Products

Required fields are marked with *

My Review for All NLRP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon