Recombinant Human NLRP3 protein, His-tagged
Cat.No. : | NLRP3-3835H |
Product Overview : | Recombinant Human NLRP3 protein(937-1036 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 937-1036 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NLRP3 NLR family, pyrin domain containing 3 [ Homo sapiens ] |
Official Symbol | NLRP3 |
Synonyms | NLRP3; NLR family, pyrin domain containing 3; C1orf7, CIAS1, cold autoinflammatory syndrome 1; NACHT, LRR and PYD domains-containing protein 3; AGTAVPRL; AII; AVP; CLR1.1; Cryopyrin; FCAS; FCU; MWS; NALP3; nucleotide binding oligomerization domain; leucine rich repeat and pyrin domain containing 3; PYPAF1; cryopyrin; caterpiller protein 1.1; PYRIN-containing APAF1-like protein 1; NACHT, LRR and PYD containing protein 3; cold autoinflammatory syndrome 1 protein; NACHT domain-, leucine-rich repeat-, and PYD-containing protein 3; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 3; CIAS1; C1orf7; FLJ95925; |
Gene ID | 114548 |
mRNA Refseq | NM_001079821 |
Protein Refseq | NP_001073289 |
MIM | 606416 |
UniProt ID | Q96P20 |
◆ Recombinant Proteins | ||
NLRP3-01H | Recombinant Human NLRP3 Protein, His/FLAG-tagged | +Inquiry |
NLRP3-2866R | Recombinant Rhesus Macaque NLRP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NLRP3-6097M | Recombinant Mouse NLRP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NLRP3-3835H | Recombinant Human NLRP3 protein, His-tagged | +Inquiry |
NLRP3-4645H | Recombinant Human NLRP3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLRP3-3799HCL | Recombinant Human NLRP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NLRP3 Products
Required fields are marked with *
My Review for All NLRP3 Products
Required fields are marked with *
0
Inquiry Basket