Recombinant Human NOS3 Protein, GST-tagged

• Cat.No.: NOS3-5993H
• Product Overview: Human NOS3 partial ORF ( AAH63294.1, 61 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. Variations in this gene are associated with susceptibility to coronary spasm. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAAT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOS3 nitric oxide synthase 3 (endothelial cell) [ Homo sapiens ]
• Official Symbol: NOS3
• Synonyms: NOS3; nitric oxide synthase 3 (endothelial cell); nitric oxide synthase, endothelial; ECNOS; endothelial nitric oxide synthase; eNOS; cNOS; EC-NOS; NOSIII; NOS type III; endothelial NOS; constitutive NOS
• Gene ID: 4846
• mRNA Refseq: NM_000603
• Protein Refseq: NP_000594
• UniProt ID: P29474