Recombinant Human NOS3 Protein, GST-tagged
Cat.No. : | NOS3-5993H |
Product Overview : | Human NOS3 partial ORF ( AAH63294.1, 61 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. Variations in this gene are associated with susceptibility to coronary spasm. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAAT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOS3 nitric oxide synthase 3 (endothelial cell) [ Homo sapiens ] |
Official Symbol | NOS3 |
Synonyms | NOS3; nitric oxide synthase 3 (endothelial cell); nitric oxide synthase, endothelial; ECNOS; endothelial nitric oxide synthase; eNOS; cNOS; EC-NOS; NOSIII; NOS type III; endothelial NOS; constitutive NOS; |
Gene ID | 4846 |
mRNA Refseq | NM_000603 |
Protein Refseq | NP_000594 |
UniProt ID | P29474 |
◆ Recombinant Proteins | ||
NOS3-1156H | Recombinant Human NOS3 Protein, MYC/DDK-tagged | +Inquiry |
NOS3-157HFL | Recombinant Full Length Human NOS3 Protein, C-Flag-tagged | +Inquiry |
NOS3-7859P | Recombinant Pig NOS3 protein, His-tagged | +Inquiry |
NOS3-6567H | Recombinant Human NOS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NOS3-4025R | Recombinant Rat NOS3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOS3-1206HCL | Recombinant Human NOS3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOS3 Products
Required fields are marked with *
My Review for All NOS3 Products
Required fields are marked with *
0
Inquiry Basket