Recombinant Human NPC2 Protein
| Cat.No. : | NPC2-826H |
| Product Overview : | Recombinant human NPC2 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Protein Length : | 151 |
| Description : | This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. |
| Form : | Lyophilized |
| Molecular Mass : | 16.5 kDa |
| AA Sequence : | MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL |
| Purity : | > 98% |
| Applications : | Migration Assay; WB; ELISA; |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution (reconst). |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | NPC2 Niemann-Pick disease, type C2 [ Homo sapiens (human) ] |
| Official Symbol | NPC2 |
| Synonyms | NPC2; Niemann-Pick disease, type C2; epididymal secretory protein E1; EDDM1; epididymal protein 1; HE1; NP C2; tissue-specific secretory protein; human epididymis-specific protein 1; niemann-Pick disease type C2 protein; MGC1333; |
| Gene ID | 10577 |
| mRNA Refseq | NM_006432 |
| Protein Refseq | NP_006423 |
| MIM | 601015 |
| UniProt ID | P61916 |
| ◆ Recombinant Proteins | ||
| NPC2-1665D | Recombinant Dog NPC2 Protein (22-149 aa), His-tagged | +Inquiry |
| NPC2-2897R | Recombinant Rhesus Macaque NPC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NPC2-3078R | Recombinant Rhesus monkey NPC2 Protein, His-tagged | +Inquiry |
| NPC2-1811H | Recombinant Human NPC2 protein, His & GST-tagged | +Inquiry |
| NPC2-6611HF | Recombinant Full Length Human NPC2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPC2-001HCL | Recombinant Human NPC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPC2 Products
Required fields are marked with *
My Review for All NPC2 Products
Required fields are marked with *



