Recombinant Human NPC2 Protein

• Cat.No.: NPC2-826H
• Product Overview: Recombinant human NPC2 protein without tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Protein Length: 151
• Description: This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy.
• Form: Lyophilized
• Molecular Mass: 16.5 kDa
• AA Sequence: MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
• Purity: > 98%
• Applications: Migration Assay; WB; ELISA
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution (reconst).
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: NPC2 Niemann-Pick disease, type C2 [ Homo sapiens (human) ]
• Official Symbol: NPC2
• Synonyms: NPC2; Niemann-Pick disease, type C2; epididymal secretory protein E1; EDDM1; epididymal protein 1; HE1; NP C2; tissue-specific secretory protein; human epididymis-specific protein 1; niemann-Pick disease type C2 protein; MGC1333
• Gene ID: 10577
• mRNA Refseq: NM_006432
• Protein Refseq: NP_006423
• MIM: 601015
• UniProt ID: P61916