Recombinant Human NPC2 Protein

Cat.No. : NPC2-826H
Product Overview : Recombinant human NPC2 protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Protein Length : 151
Description : This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy.
Form : Lyophilized
Molecular Mass : 16.5 kDa
AA Sequence : MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Purity : > 98%
Applications : Migration Assay; WB; ELISA;
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution (reconst).
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name NPC2 Niemann-Pick disease, type C2 [ Homo sapiens (human) ]
Official Symbol NPC2
Synonyms NPC2; Niemann-Pick disease, type C2; epididymal secretory protein E1; EDDM1; epididymal protein 1; HE1; NP C2; tissue-specific secretory protein; human epididymis-specific protein 1; niemann-Pick disease type C2 protein; MGC1333;
Gene ID 10577
mRNA Refseq NM_006432
Protein Refseq NP_006423
MIM 601015
UniProt ID P61916

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPC2 Products

Required fields are marked with *

My Review for All NPC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon